DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccdc58 and mix23

DIOPT Version :9

Sequence 1:NP_730454.2 Gene:Ccdc58 / 40159 FlyBaseID:FBgn0036909 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001016242.1 Gene:mix23 / 548996 XenbaseID:XB-GENE-5730553 Length:144 Species:Xenopus tropicalis


Alignment Length:129 Identity:54/129 - (41%)
Similarity:87/129 - (67%) Gaps:1/129 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CLDFLGFQEALKKMRDVDDKIIYALN-ALPTESFKGQVNSESTCRDLYAKLQESHLARQESIRSC 68
            |.||..|||.|:.||.:||:|::.|| .:||.||.|::::..||:.||..||::|.:|.::|:.|
 Frog    10 CEDFTEFQEILRVMRTIDDRIVHELNTTVPTVSFAGKIDAGQTCKQLYQSLQDAHSSRDKAIKRC 74

  Fly    69 ITISASNLKKLREKRETQPDDVDTDNQFRAEQRKLRVLQAELNVEDIIKDRSYKTFNERCRSYF 132
            |..:::.:..|:.:|....|::......|.||.||:.|::|||||:::.|||.|.||||||.::
 Frog    75 IAQTSTAVNNLQAERLKDSDNLALIKLLRKEQSKLKFLKSELNVEEVVNDRSLKVFNERCRLHY 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccdc58NP_730454.2 Cid2 5..128 CDD:286815 51/123 (41%)
mix23NP_001016242.1 Cid2 10..134 CDD:370680 51/123 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 115 1.000 Domainoid score I5962
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H18028
Inparanoid 1 1.050 116 1.000 Inparanoid score I4670
OMA 1 1.010 - - QHG52229
OrthoDB 1 1.010 - - D1574254at2759
OrthoFinder 1 1.000 - - FOG0006571
OrthoInspector 1 1.000 - - otm47752
Panther 1 1.100 - - LDO PTHR31905
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5693
SonicParanoid 1 1.000 - - X6318
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1313.110

Return to query results.
Submit another query.