DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ccdc58 and Mix23

DIOPT Version :9

Sequence 1:NP_730454.2 Gene:Ccdc58 / 40159 FlyBaseID:FBgn0036909 Length:136 Species:Drosophila melanogaster
Sequence 2:NP_001099345.1 Gene:Mix23 / 288065 RGDID:1564582 Length:144 Species:Rattus norvegicus


Alignment Length:129 Identity:60/129 - (46%)
Similarity:91/129 - (70%) Gaps:1/129 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 CLDFLGFQEALKKMRDVDDKIIYALN-ALPTESFKGQVNSESTCRDLYAKLQESHLARQESIRSC 68
            |.:|..|||.||.||.:||:|::.|| .:||.||.|::::..||:.||..|..:|::|...|::|
  Rat    10 CEEFAEFQELLKVMRTIDDRIVHELNTTVPTASFAGKIDASQTCKQLYESLMAAHVSRDRVIKNC 74

  Fly    69 ITISASNLKKLREKRETQPDDVDTDNQFRAEQRKLRVLQAELNVEDIIKDRSYKTFNERCRSYF 132
            |..:::.:|:|||:||...||:....|.|.||.||:.:|:|||||:::.|||:|.||||||.:|
  Rat    75 IAQTSAVVKRLREEREKNLDDLTLLKQLRKEQTKLKWMQSELNVEEVVNDRSWKVFNERCRIHF 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ccdc58NP_730454.2 Cid2 5..128 CDD:286815 56/123 (46%)
Mix23NP_001099345.1 Cid2 10..134 CDD:286815 56/123 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338503
Domainoid 1 1.000 127 1.000 Domainoid score I5263
eggNOG 1 0.900 - - E1_KOG4613
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H18028
Inparanoid 1 1.050 129 1.000 Inparanoid score I4557
OMA 1 1.010 - - QHG52229
OrthoDB 1 1.010 - - D1574254at2759
OrthoFinder 1 1.000 - - FOG0006571
OrthoInspector 1 1.000 - - oto95927
orthoMCL 1 0.900 - - OOG6_107070
Panther 1 1.100 - - LDO PTHR31905
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6318
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.