DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TORIP and si:dkeyp-82a1.6

DIOPT Version :9

Sequence 1:NP_001262065.1 Gene:TORIP / 40158 FlyBaseID:FBgn0036908 Length:301 Species:Drosophila melanogaster
Sequence 2:XP_001339602.3 Gene:si:dkeyp-82a1.6 / 100005391 ZFINID:ZDB-GENE-081105-150 Length:548 Species:Danio rerio


Alignment Length:397 Identity:76/397 - (19%)
Similarity:127/397 - (31%) Gaps:134/397 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ARRPL----HGNEPGALSQSKDDVDQ---DHSYNRQPVQSYEEGTSSA--DELEESESHDEPSIP 60
            |.||.    ...|.|.:.:.:..:.:   ||..::..:.:....||.|  ...|...:..:.||.
Zfish   132 AARPAQVRRENRESGVVLERRRSIHENCLDHDIHKHNIPNRSITTSQALSGREERFPAVRQRSIR 196

  Fly    61 KPTDQS--RR------RSISTSR-PS------SRQEQHNSI---NEHHNG--------------- 92
            :.|||.  ||      ||.:||: ||      ||....|.:   :.||.|               
Zfish   197 EKTDQETHRRPKTVNIRSETTSQAPSVTRVTRSRVTNQNPVVINDAHHFGNWNRSQLLIPPTTNQ 261

  Fly    93 ----------------------------IGIKLALAGVLFGLLVVYGY----------------- 112
                                        |...|.|..:|.||| |.||                 
Zfish   262 TAHHKTTEKKPVFSKPSPVSPTRGWMWSICRVLILVLILTGLL-VSGYLIYHKFISAHLPQTDVV 325

  Fly   113 GSSIIEEKQCDFKDLRTKYPQQQEKVWRALQKGIEGLINKKDKHPSVFLFLHQDPKLEKLIDEIA 177
            .|..::....|...|:|.:|.|:.:.|:...|.::..:........|.:.|....:.|:.:..:|
Zfish   326 HSETLKNFAVDLAGLQTVFPSQRSEFWKRSGKHLKSHLQTVKPTEPVSVILTAGLRAERTLGCLA 390

  Fly   178 IEASMCFGGPRKLIHMKKEHMKEYGLAIEQFKSKINDG--KVF-------LIVNLNEIAPNGARA 233
            ...:..|........::.....:..|..:|.|.:|::.  |.|       ::.|..|:.|.....
Zfish   391 RRLATMFSAFHNASILEINGNSKSALDSDQVKLEIDEALKKAFEGDKPAAVVHNFEELPPGSTLI 455

  Fly   234 LHTICDTYSPLVEDAVIFLSLRTFNTTAVNN-----SVNLATDTLYDLWDQELGDHELDPLI--T 291
            .:..||                 ..|.|..|     :|.|:.|             |:||.:  :
Zfish   456 FYRYCD-----------------HETAAYKNVFLVFTVKLSVD-------------EIDPSVSLS 490

  Fly   292 RVTDQVL 298
            :|.:.||
Zfish   491 QVEEMVL 497

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TORIPNP_001262065.1 None
si:dkeyp-82a1.6XP_001339602.3 LAP1C <250..546 CDD:283300 46/279 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR18843
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
22.060

Return to query results.
Submit another query.