Sequence 1: | NP_001097647.3 | Gene: | Ir76a / 40157 | FlyBaseID: | FBgn0260874 | Length: | 646 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001261621.2 | Gene: | GluRIB / 44484 | FlyBaseID: | FBgn0264000 | Length: | 1182 | Species: | Drosophila melanogaster |
Alignment Length: | 255 | Identity: | 39/255 - (15%) |
---|---|---|---|
Similarity: | 75/255 - (29%) | Gaps: | 89/255 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 299 GLVGMILDRRNDYGVGGMYLWYEAYEYMDMTHFLGRSGVTCLVPAPNRLISWTL-LLRPFQFVLW 362
Fly 363 MCVMLCLLLESLALGITRR-----WE--------------------------------------- 383
Fly 384 ----------------HSSVAAG------------------NS-WISSLRFGCISTLKLFVNQST 413
Fly 414 NYVTSSYALRTVLVASYMIDIILTTVYSGGLAAILTLPTLEEAADSRQRLFDHKLIWTGT 473 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ir76a | NP_001097647.3 | None | |||
GluRIB | NP_001261621.2 | PBP1_iGluR_AMPA | 43..478 | CDD:107375 | |
ANF_receptor | 55..461 | CDD:279440 | |||
PBP2_iGluR_AMPA | 497..938 | CDD:270433 | 39/255 (15%) | ||
Lig_chan | 632..967 | CDD:278489 | 29/193 (15%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45462547 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |