DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir76a and GluRIB

DIOPT Version :9

Sequence 1:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001261621.2 Gene:GluRIB / 44484 FlyBaseID:FBgn0264000 Length:1182 Species:Drosophila melanogaster


Alignment Length:255 Identity:39/255 - (15%)
Similarity:75/255 - (29%) Gaps:89/255 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 GLVGMILDRRNDYGVGGMYLWYEAYEYMDMTHFLGRSGVTCLVPAPNRLISWTL-LLRPFQFVLW 362
            |:||.::.:..|..:..|.:..|....:|.:......|::.::..|.:...... .:.|....:|
  Fly   570 GMVGELVRKEADIAIAAMTITAERERVIDFSKPFMSLGISIMIKKPVKQTPGVFSFMNPLSQEIW 634

  Fly   363 MCVMLCLLLESLALGITRR-----WE--------------------------------------- 383
            :.|:...:..|:.|....|     |.                                       
  Fly   635 VSVIFSYIGVSIVLFFVSRFSPHEWRLVQQQPQQSQSPDPHAHHEQLANQQPPGIIGGAPLPAPP 699

  Fly   384 ----------------HSSVAAG------------------NS-WISSLRFGCISTLKLFVNQST 413
                            .::::||                  || |.|         |..|:.|..
  Fly   700 GPPTPGAQTAAGAAALQAALSAGSPGSGGSSSAVVNEFSVWNSFWFS---------LAAFMQQGC 755

  Fly   414 NYVTSSYALRTVLVASYMIDIILTTVYSGGLAAILTLPTLEEAADSRQRLFDHKLIWTGT 473
            :....|.:.|....:.:...:||.:.|:..|||.||:..:....:|.:.|.....:..||
  Fly   756 DLSPRSVSGRIAAASWFFFTLILISSYTANLAAFLTVERMVTPINSPEDLAMQTEVQYGT 815

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir76aNP_001097647.3 None
GluRIBNP_001261621.2 PBP1_iGluR_AMPA 43..478 CDD:107375
ANF_receptor 55..461 CDD:279440
PBP2_iGluR_AMPA 497..938 CDD:270433 39/255 (15%)
Lig_chan 632..967 CDD:278489 29/193 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462547
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.