DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir76a and Ir93a

DIOPT Version :9

Sequence 1:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_650924.3 Gene:Ir93a / 42471 FlyBaseID:FBgn0259215 Length:868 Species:Drosophila melanogaster


Alignment Length:325 Identity:75/325 - (23%)
Similarity:120/325 - (36%) Gaps:57/325 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   344 PNRLISWTLLLRPFQFVLWMCVMLCLLLESLALGITRRWEHSSVAAGNSWISSLRFGCISTLK-- 406
            |:.:....|...||....|.|:|..:||.:..|....|.         :.:..:|...:||:|  
  Fly   560 PDEVSRIYLFTAPFTVETWFCLMGIILLTAPTLYAINRL---------APLKEMRIVGLSTVKSC 615

  Fly   407 ------LFVNQSTNYVTSSYALRTVLVASYMIDIILTTVYSGGLAAILTLPTLEEAADSRQRLFD 465
                  ..:.|...|:.::.:.|.|:...:::.|:|.|.|.|.|.|.||.|..:...|...:|.|
  Fly   616 FWYIFGALLQQGGMYLPTADSGRLVVGFWWIVVIVLVTTYCGNLVAFLTFPKFQPGVDYLNQLED 680

  Fly   466 HK-LIWTGTSQAWITTIDERSADPVLLGLMEHY----RVYDANLISAFSHTEQMGFVV--ERLQF 523
            || ::..|....   |..||..........:||    ::|.:      :..|.:..|.  ||:..
  Fly   681 HKDIVQYGLRNG---TFFERYVQSTTREDFKHYLERAKIYGS------AQEEDIEAVKRGERINI 736

  Fly   524 GHLGNTELIENDALKRLKLMVDDIYFAF---------TVAFVPRLWPHLNAYNDFILAWHSSGFD 579
            ....|.:||.....:|.|    :.:||.         ....||....:|:..|..|.:....||.
  Fly   737 DWRINLQLIVQRHFEREK----ECHFALGRESFVDEQIAMIVPAQSAYLHLVNRHIKSMFRMGFI 797

  Fly   580 KFWEWK--IAAEYMNAHRQNRIVASEKTNLDIGPVKLGIDNFIGLILLWCFGMICSLLTFLGELW 642
            :.|...  .:|...|.....|.|.:.|.|:         |:..|..|:...|...:||...||.|
  Fly   798 ERWHQMNLPSAGKCNGKSAQRQVTNHKVNM---------DDMQGCFLVLLLGFTLALLIVCGEFW 853

  Fly   643  642
              Fly   854  853

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir76aNP_001097647.3 None
Ir93aNP_650924.3 Periplasmic_Binding_Protein_Type_2 429..>697 CDD:328725 36/148 (24%)
Lig_chan 576..836 CDD:306551 64/290 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462905
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.