DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir76a and Ir87a

DIOPT Version :9

Sequence 1:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_650290.2 Gene:Ir87a / 41654 FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster


Alignment Length:467 Identity:80/467 - (17%)
Similarity:167/467 - (35%) Gaps:110/467 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 RNLKGREVVIGIFDYKPFMLLDYEKPPL---YY------DRFMNTT------------------- 255
            |:|.|..:......::|::..:.|:.|:   ||      |.:.:|:                   
  Fly   329 RDLSGCPLTASFRPWEPYIFRNSEEQPVDDYYYGLQGDEDDYNDTSPNYGESDDESYADPGEDGD 393

  Fly   256 ------------DVTIDGTDIQLMLIFCELYNCTIQVDTSEPYDWGDIYLNASGYGLVGMILDRR 308
                        .:.:.|.:.:::....|..:.:|::.       |:   |::.|.|...::|..
  Fly   394 GAIPDTETQSGGKLKLSGIEYEMVQTIAERLHVSIEMQ-------GE---NSNLYHLFQQLIDGE 448

  Fly   309 NDYGVGGMYLWYEAYEYMDMTHFLGRSGVTCLVPAPNRLISWTL-----------LLRPFQ---- 358
            .:..|||:      .|...::.|:..|     :|.....::|.:           .:..|.    
  Fly   449 IEMIVGGI------DEDPSISQFVSSS-----IPYHQDELTWCVARAKRRHGFFNFVATFNADAG 502

  Fly   359 FVLWMCVMLCLLLESLALGITRRWEHSSVAAGNSWISSLRFGCISTLKLFVNQSTNYVTSSYALR 423
            |::.:.|:.|    ||.:.:.:|.....:...|.:..:    |:..|.:.:||:.........||
  Fly   503 FLIGIFVVTC----SLVVWLAQRVSGFQLRNLNGYFPT----CLRVLGILLNQAIPAQDFPITLR 559

  Fly   424 TVLVASYMIDIILTTVYSGGLAAILTLPTLEEAADSRQRLFDHKLIWTGTSQAWITTIDERSAD- 487
            .:...|:::....:..|...|.:.||.|.......:.|.::.:|:...|||:    .:...:.| 
  Fly   560 QLFALSFLMGFFFSNTYQSFLISTLTTPRSSYQIHTLQEIYSNKMTVMGTSE----HVRHLNKDG 620

  Fly   488 PVLLGLMEHYRV-YDANLISAFSHTEQMGFVVERLQFGHLGNTELIENDAL----KRLKLMVDDI 547
            .:...:.|.::: |  ||:...:...|...:...:...|......|:.|.|    :|     :.:
  Fly   621 EIFKYIREKFQMCY--NLVDCLNDAAQNEHIAVAVSRQHSFYNPRIQRDRLYCFDRR-----ESL 678

  Fly   548 YFAFTVAFVPRLWPHLNAYNDFILAWHSSGFDKFWEWKIAAEYMNAHRQNRIVASEKTNLDIGPV 612
            |.......:|:.:..|:..|..|.....||..:.|...:        ...|::..|.|.:...|.
  Fly   679 YVYLVTMLLPKKYHLLHQINPVIQHIIESGHMQKWARDL--------DMRRMIHEEITRVREDPF 735

  Fly   613 K-LGIDNFIGLI 623
            | |..|.|.|.|
  Fly   736 KALTFDQFRGAI 747

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir76aNP_001097647.3 None
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 15/87 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.