DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir76a and Ir64a

DIOPT Version :9

Sequence 1:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_647962.1 Gene:Ir64a / 38616 FlyBaseID:FBgn0035604 Length:859 Species:Drosophila melanogaster


Alignment Length:136 Identity:29/136 - (21%)
Similarity:62/136 - (45%) Gaps:20/136 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 TIDGTDIQLMLIFCELYNCTIQVDTSEPYDWGDIYLNASGYGLVGMILDRRNDYGVGGMYLWYEA 322
            |::..:..|::...:::|.|..:  |....||.: .|....|::|.::....|.|...::.|.|.
  Fly   341 TMNRFNFNLLMAVRDMFNWTFVL--SRTTSWGYV-KNGRFDGMIGALIRNETDIGGAPIFYWLER 402

  Fly   323 YEYMDMTHFLGRSGVT--CLV------PAPNRLISWTLLLRPFQFVLWMCVMLCLLLESLALGI- 378
            ::::|:.   |||..:  |.:      ...:|::    .|:||...:|:.::.|.:|....|.. 
  Fly   403 HKWIDVA---GRSWSSRPCFIFRHPRSTQKDRIV----FLQPFTNDVWILIVGCGVLTVFILWFL 460

  Fly   379 -TRRWE 383
             |..|:
  Fly   461 TTIEWK 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir76aNP_001097647.3 None
Ir64aNP_647962.1 Periplasmic_Binding_Protein_Type_2 351..>465 CDD:304360 26/123 (21%)
Lig_chan 563..828 CDD:278489
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462938
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.