DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir76a and gria4b

DIOPT Version :9

Sequence 1:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_997917.2 Gene:gria4b / 336069 ZFINID:ZDB-GENE-030131-8013 Length:904 Species:Danio rerio


Alignment Length:335 Identity:62/335 - (18%)
Similarity:120/335 - (35%) Gaps:71/335 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 FEIKTNRFVGPRNFNKNPEPVEFYILQRFDAKGTKATWETQSAMSSKMRNLKGREVVIGIFDYKP 235
            ||:|:|   |||......:..:..:.|            ..:.:.::...::.|.|::......|
Zfish   377 FELKSN---GPRRIGYWNDADKLVLTQ------------DHALLPNETSGMENRTVIVTTIMEGP 426

  Fly   236 FMLLD-----YEKPPLYYDRFMNTTDVTIDGTDIQLMLIFCE----LYNCTIQVD------TSEP 285
            :::|.     ||....|            :|..:.|.....:    .|..:|..|      ..|.
Zfish   427 YVMLKKNWEMYEGNEQY------------EGYCVDLASEIAKHIGFKYKISIVPDGKYGARDPET 479

  Fly   286 YDWGDIYLNASGYGLVGMILDRRNDYGVGGMYLWYEAYEYMDMTHFLGRSGVTCLVPAPNR---- 346
            ..|.         |:||.::..:.:..|..:.:.....|.:|.:......|::.::..|.:    
Zfish   480 KIWN---------GMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPG 535

  Fly   347 LISWTLLLRPFQFVLWMCVMLCLLLESLALGITRR-----WEHSSVAAGNSWISS----LRFGCI 402
            :.|:   |.|..:.:|||::...:..|:.|.:..|     |.......|...:.|    ..||..
Zfish   536 VFSF---LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGTDGLPSDQPPNEFGIF 597

  Fly   403 S----TLKLFVNQSTNYVTSSYALRTVLVASYMIDIILTTVYSGGLAAILTLPTLEEAADSRQRL 463
            :    :|..|:.|..:....|.:.|.|....:...:|:.:.|:..|||.||:..:....:|.:.|
Zfish   598 NSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL 662

  Fly   464 FDHKLIWTGT 473
            .....|..||
Zfish   663 AKQTDIAYGT 672

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir76aNP_001097647.3 None
gria4bNP_997917.2 Periplasmic_Binding_Protein_Type_1 28..398 CDD:324556 7/23 (30%)
PBP2_iGluR_AMPA_GluR4 414..793 CDD:270445 54/283 (19%)
Lig_chan 546..827 CDD:306551 29/127 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170591673
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.