DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir76a and Ir11a

DIOPT Version :10

Sequence 1:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_572795.2 Gene:Ir11a / 32189 FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster


Alignment Length:116 Identity:26/116 - (22%)
Similarity:35/116 - (30%) Gaps:33/116 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   420 LQFCNLNSFRTKFILGFSVFMGLSIPQYFNQYTAVNKYGPVHTHA------------RWFNDMIN 472
            |:...|||..:|.:|..|..    :..|...|.....:.|:.|..            .|.||  .
  Fly   339 LEIVQLNSRLSKNVLRTSKV----VENYLAYYEQRRVFDPLLTPPGSQADPFQSQPNPWIND--T 397

  Fly   473 VPFSSKAFVAGILAFFLDVTMSSKDSATRKDRGMFWWDRFMSFKSDTRSEE 523
            |.|.....:.|             |..||  |...|.|.|....:|:...|
  Fly   398 VDFWQHDKITG-------------DIQTR--RLKLWEDSFEELLADSLGRE 433

Return to query results.
Submit another query.