DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir76a and Gria4

DIOPT Version :9

Sequence 1:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001106655.1 Gene:Gria4 / 29629 RGDID:61863 Length:902 Species:Rattus norvegicus


Alignment Length:387 Identity:80/387 - (20%)
Similarity:139/387 - (35%) Gaps:80/387 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 GLVGMILDRRNDYGVGGMYLWYEAYEYMDMTHFLGRSGVTCLVPAPNR----LISWTLLLRPFQF 359
            |:||.::..:.:..:..:.:.....|.:|.:......|::.::..|.:    :.|:   |.|..:
  Rat   484 GMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF---LDPLAY 545

  Fly   360 VLWMCVMLCLLLESLALGITRR-----WEHSSVAAGNSWISSL---RFGCIS----TLKLFVNQS 412
            .:|||::...:..|:.|.:..|     |.......|....|..   .||..:    :|..|:.|.
  Rat   546 EIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQG 610

  Fly   413 TNYVTSSYALRTVLVASYMIDIILTTVYSGGLAAILTLPTLEEAADSRQRLFDHKLIWTGTSQAW 477
            .:....|.:.|.|....:...:|:.:.|:..|||.||:..:....:|.:.|.....|..||..:.
  Rat   611 CDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSG 675

  Fly   478 IT---------TIDE------RSADPVLLGLMEHYRVYDANLISAFSHTEQMGFVVERLQFGH-- 525
            .|         .:.|      |||:|                 |.|:.|...|....|...|.  
  Rat   676 STKEFFRRSKIAVYEKMWTYMRSAEP-----------------SVFTRTTAEGVARVRKSKGKFA 723

  Fly   526 --LGNT--ELIEN----DALKRLKLMVDDIYFAFTVAFVPRLWPHLNAYNDFILAWHSSG-FDKF 581
              |.:|  |.||.    |.:|....:....|...|    |:.....||.|..:|..:..| .||.
  Rat   724 FLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVAT----PKGSSLRNAVNLAVLKLNEQGLLDKL 784

  Fly   582 ---WEWKIAAEYMNAHRQNRIVASEKTNLDIGPVKLGIDNFIGLILLWCFGMICSLLTFLGE 640
               | |....|..:....::    :||:      .|.:.|..|:..:...|:..::|..|.|
  Rat   785 KNKW-WYDKGECGSGGGDSK----DKTS------ALSLSNVAGVFYILVGGLGLAMLVALIE 835

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir76aNP_001097647.3 None
Gria4NP_001106655.1 PBP1_iGluR_AMPA_GluR4 28..398 CDD:107383
ANF_receptor 39..380 CDD:279440
PBP2_iGluR_AMPA_GluR4 414..795 CDD:270445 70/335 (21%)
Lig_chan 546..825 CDD:278489 66/310 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350114
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.