DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir76a and GRIK3

DIOPT Version :9

Sequence 1:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_000822.2 Gene:GRIK3 / 2899 HGNCID:4581 Length:919 Species:Homo sapiens


Alignment Length:488 Identity:91/488 - (18%)
Similarity:170/488 - (34%) Gaps:142/488 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 NLKGREVVIGIFDYKPFMLLDYEKPPLY-YDRFMNTTDVTIDGTDIQLMLIFCELYNCTIQVDTS 283
            :|..|.:::.....:||::.......|| .|||        :|..|.|:.....:...:.::...
Human   430 SLTNRSLIVTTVLEEPFVMFRKSDRTLYGNDRF--------EGYCIDLLKELAHILGFSYEIRLV 486

  Fly   284 EPYDWGDIYLNASGYGLVGMILDRRNDYGVGGMYLWYEAYEYMDMTHFLGRSGVTCLVPAPN--- 345
            |...:|.........|:|..::|.:.|..|..:.:.:...:.:|.:......||:.|...||   
Human   487 EDGKYGAQDDKGQWNGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGVSILYRKPNGTN 551

  Fly   346 -RLISWTLLLRPFQFVLWMCVMLCLLLESLALGITRRWE-------H-----SSVAAGN-SWISS 396
             .:.|:   |.|....:||.|:|..|..|..|.:..|:.       |     |.|...| :.::|
Human   552 PSVFSF---LNPLSPDIWMYVLLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSEVVENNFTLLNS 613

  Fly   397 LRFGCISTLKLFVNQSTNYVTSSYALRTVLVASYMIDIILTTVYSGGLAAILTLPTLEEAADS-- 459
            ..||..|.::    |.:..:..:.:.|.:....:...:|:.:.|:..|||.||:..:|...||  
Human   614 FWFGMGSLMQ----QGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSAD 674

  Fly   460 ---RQRLFDHKLIWTGTSQAW-----ITTIDER-----------------------SADPVLL-- 491
               :|...::..:..|.:..:     |:|.::.                       :||..||  
Human   675 DLAKQTKIEYGAVKDGATMTFFKKSKISTFEKMWAFMSSKPSALVKNNEEGIQRALTADYALLME 739

  Fly   492 -GLMEHYRVYDANLISAFSHTEQMGFVVERLQFG---HLGN----------TELIENDALKRLKL 542
             ..:|:....:.||       .|:|.:::...:|   .:|:          .:|.|.|.|..:| 
Human   740 STTIEYVTQRNCNL-------TQIGGLIDSKGYGIGTPMGSPYRDKITIAILQLQEEDKLHIMK- 796

  Fly   543 MVDDIYFAFTVAFVPRLWPHLNAYNDFILAWHSSGFDKFWEWKIAAEYMNAHRQNRIVASEKTNL 607
                           ..|            |..||                       ..|:.|.
Human   797 ---------------EKW------------WRGSG-----------------------CPEEENK 811

  Fly   608 DIGPVKLGIDNFIGLILLWCFGMICSLLTFLGE 640
            :..  .|||....|:.::...|::.|:|..:||
Human   812 EAS--ALGIQKIGGIFIVLAAGLVLSVLVAVGE 842

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir76aNP_001097647.3 None
GRIK3NP_000822.2 PBP1_iGluR_Kainate_GluR5_7 34..417 CDD:107388
ANF_receptor 55..398 CDD:279440
PBP2_iGluR_Kainate_GluR7 433..801 CDD:270441 76/417 (18%)
Lig_chan 564..832 CDD:278489 58/331 (18%)
Glutamate binding. /evidence=ECO:0000250 690..692 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156183
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.