DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir76a and GRIA3

DIOPT Version :9

Sequence 1:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_000819.4 Gene:GRIA3 / 2892 HGNCID:4573 Length:894 Species:Homo sapiens


Alignment Length:197 Identity:43/197 - (21%)
Similarity:79/197 - (40%) Gaps:29/197 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 GLVGMILDRRNDYGVGGMYLWYEAYEYMDMTHFLGRSGVTCLVPAPNR----LISWTLLLRPFQF 359
            |:||.::..|.|..|..:.:.....|.:|.:......|::.::..|.:    :.|:   |.|..:
Human   492 GMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF---LDPLAY 553

  Fly   360 VLWMCVMLCLLLESLALGITRR-----WE-----------HSSVAAGNSW--ISSLRFGCISTLK 406
            .:|||::...:..|:.|.:..|     |.           .|.....|.:  .:||.|    :|.
Human   554 EIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPPNEFGIFNSLWF----SLG 614

  Fly   407 LFVNQSTNYVTSSYALRTVLVASYMIDIILTTVYSGGLAAILTLPTLEEAADSRQRLFDHKLIWT 471
            .|:.|..:....|.:.|.|....:...:|:.:.|:..|||.||:..:....:|.:.|.....|..
Human   615 AFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAY 679

  Fly   472 GT 473
            ||
Human   680 GT 681

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir76aNP_001097647.3 None
GRIA3NP_000819.4 PBP1_iGluR_AMPA_GluR3 35..409 CDD:380610
PBP2_iGluR_AMPA 422..805 CDD:270433 43/197 (22%)
Glutamate binding. /evidence=ECO:0000250 508..510 0/1 (0%)
Glutamate binding. /evidence=ECO:0000250 686..687
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156225
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.