Sequence 1: | NP_001097647.3 | Gene: | Ir76a / 40157 | FlyBaseID: | FBgn0260874 | Length: | 646 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_000819.4 | Gene: | GRIA3 / 2892 | HGNCID: | 4573 | Length: | 894 | Species: | Homo sapiens |
Alignment Length: | 197 | Identity: | 43/197 - (21%) |
---|---|---|---|
Similarity: | 79/197 - (40%) | Gaps: | 29/197 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 299 GLVGMILDRRNDYGVGGMYLWYEAYEYMDMTHFLGRSGVTCLVPAPNR----LISWTLLLRPFQF 359
Fly 360 VLWMCVMLCLLLESLALGITRR-----WE-----------HSSVAAGNSW--ISSLRFGCISTLK 406
Fly 407 LFVNQSTNYVTSSYALRTVLVASYMIDIILTTVYSGGLAAILTLPTLEEAADSRQRLFDHKLIWT 471
Fly 472 GT 473 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Ir76a | NP_001097647.3 | None | |||
GRIA3 | NP_000819.4 | PBP1_iGluR_AMPA_GluR3 | 35..409 | CDD:380610 | |
PBP2_iGluR_AMPA | 422..805 | CDD:270433 | 43/197 (22%) | ||
Glutamate binding. /evidence=ECO:0000250 | 508..510 | 0/1 (0%) | |||
Glutamate binding. /evidence=ECO:0000250 | 686..687 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165156225 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |