DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir76a and Ir52b

DIOPT Version :9

Sequence 1:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_725469.2 Gene:Ir52b / 246631 FlyBaseID:FBgn0050469 Length:596 Species:Drosophila melanogaster


Alignment Length:501 Identity:111/501 - (22%)
Similarity:188/501 - (37%) Gaps:135/501 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 RNRFMFVYTKEFEDKKDSYLSGYIFQDQPNILVITSQYLNSSTFEIKTNRFVGPRNFNKNPEPVE 192
            |||.:.:..::|:  ..:..:.|..::|.||.::...:..|.:  |.|.|:....|         
  Fly   109 RNRRLVLLKEDFQ--PSNICNIYTQKEQYNIALVRENFTKSKS--IYTCRYFQDPN--------- 160

  Fly   193 FYILQRFDAKGTKATWETQSAMSSKMRNLKGREVVIGIFDYKPFMLLDYEKPP---LYYDRFMNT 254
               :...:..|||..:..|      .:|:||:.:.|     .|.:|     ||   ||.|  .|.
  Fly   161 ---VDEVNLSGTKPIFIEQ------FQNMKGKAIRI-----VPDLL-----PPRVMLYQD--AND 204

  Fly   255 TDVTIDGTDIQLMLIFCELYNCTIQVDTSEPYDWGDIYLNASGYGLVGMILDRRNDYGV------ 313
            .::.:.|....|:..|.:..|.|:|:|..:|        :.|...:..|..|...|.|:      
  Fly   205 GELKMIGYVANLITNFAQKVNATLQLDFLKP--------STSITEISRMAKDDELDMGITLEASL 261

  Fly   314 GGMYLWYEAYEYMDMTHFLGRSGVTCL---VPA--PNRLISWTLLLRPFQFVLWMCVMLCLLLES 373
            ....|...:|.|: :|.:       ||   |||  |..|: :.|::.|  .||.:..:|.|||..
  Fly   262 NTSNLETSSYPYL-LTSY-------CLMVQVPAKFPYNLV-YALIVDP--LVLGIIFVLFLLLSV 315

  Fly   374 LALGITR-RWEHSSVAAGNSWISSLRFGCISTLKLFVNQSTNY-VTSSYALRTVLVASYMIDIIL 436
            |.:...: .|:..|||  |..::.      .:|:..:.||..: :.:|..||.:........|:|
  Fly   316 LLIYSQKMSWQDLSVA--NILLND------KSLRGLLGQSFPFPLNASKKLRLIFTILCFASIML 372

  Fly   437 TTVYSGGLAAILTLPTLEEAADSRQRLFDHK------------LIWTGTSQAWITTIDERSADPV 489
            ||:|...|.:..|.|..|....|.|.:..:.            ||.|..|......:|:..   :
  Fly   373 TTMYEAYLQSFFTNPPSEPEICSFQDVGSYNRRIAMSALEVNGLIKTNNSHFREIRMDDLE---I 434

  Fly   490 LLGLMEHYRVYDA-NLISAF--------SHTEQMGFVVERLQFGHLGNTELIENDALKRLKLMVD 545
            ...:.|.|.:.|| ||...:        |:.||.....|.:                        
  Fly   435 FDNMPECYELRDAFNLSYNYVVTGDRWRSYAEQQTLFKEPV------------------------ 475

  Fly   546 DIYFAFTVAF-------VP--RLWPHLNAYNDFILAWHSSGFDKFW 582
             .|||..:.|       ||  |..|:.:.:::.::..|..||..:|
  Fly   476 -FYFARDLCFSRLIFLSVPLRRHLPYRHLFDEHMMQQHEFGFVNYW 520



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR42643
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.