DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir76a and Grin2c

DIOPT Version :9

Sequence 1:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_036707.3 Gene:Grin2c / 24411 RGDID:2739 Length:1250 Species:Rattus norvegicus


Alignment Length:424 Identity:88/424 - (20%)
Similarity:153/424 - (36%) Gaps:125/424 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   290 DIYLNASG----------YGLVGMILDRRNDYGVGGMYLWYEAYEYMDMTHFLGRSGVTCLVPAP 344
            |:||..:|          .|::|.:..:|.|..:|.:.:..|..|.:|.:.....:|::.:|...
  Rat   487 DLYLVTNGKHGKRVRGVWNGMIGEVYYKRADMAIGSLTINEERSEIIDFSVPFVETGISVMVSRS 551

  Fly   345 NRLISWTLLLRPFQFVLW-MCVMLCLLLESLALGITRRWEHSSVAAGNSWIS--------SLRFG 400
            |..:|.:..|.|:...:| |..::||.:.::.:.:   :|:.|..:.|..::        |...|
  Rat   552 NGTVSPSAFLEPYSPAVWVMMFVMCLTVVAITVFM---FEYFSPVSYNQNLTKGKKPGGPSFTIG 613

  Fly   401 CISTLKLFVNQSTNYV-------TSSYALRTVLVASYMIDIILTTVYSGGLAAILTLPTLEEAAD 458
             .|...|:.....|.|       |:|..:  |||.::...|.|.: |:..|||.:   ..|:..|
  Rat   614 -KSVWLLWALVFNNSVPIENPRGTTSKIM--VLVWAFFAVIFLAS-YTANLAAFM---IQEQYID 671

  Fly   459 SRQRLFDHKLIWTGTSQAWITTIDERSAD---PVLLGLMEHYRVYDANLISAF--SHTEQMGFVV 518
            :...|.|.|.              :|..|   |...|.:.:... :.|:.|.:  .||..:.|  
  Rat   672 TVSGLSDKKF--------------QRPQDQYPPFRFGTVPNGST-ERNIRSNYRDMHTHMVKF-- 719

  Fly   519 ERLQFGHLGNTELIENDALKRLKLMVDD--IYFAFTVAFVPRLWPHLNAYND------------- 568
                     |...:| |||..||:...|  ||.|..:.::        |..|             
  Rat   720 ---------NQRSVE-DALTSLKMGKLDAFIYDAAVLNYM--------AGKDEGCKLVTIGSGKV 766

  Fly   569 FILAWHSSGFDKFWEWKIAAEY---------------------MNAHRQNRIVASEKTNLDIGPV 612
            |....:.....|...||.|.:.                     :..:.:|.:::|          
  Rat   767 FATTGYGIAMQKDSHWKRAIDLALLQLLGDGETQKLETVWLSGICQNEKNEVMSS---------- 821

  Fly   613 KLGIDNFIGLILLWCFGMICSLLTFLGE---LWR 643
            ||.|||..|:..:....|..:||.|..|   .|:
  Rat   822 KLDIDNMAGVFYMLLVAMGLALLVFAWEHLVYWK 855

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir76aNP_001097647.3 None
Grin2cNP_036707.3 PBP1_iGluR_NMDA_NR2 41..397 CDD:380601
PBP2_iGluR_NMDA_Nr2 413..813 CDD:270436 74/370 (20%)
NMDAR2_C 850..>925 CDD:402274 1/6 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350135
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.