DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir76a and glr-3

DIOPT Version :9

Sequence 1:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_492017.3 Gene:glr-3 / 172449 WormBaseID:WBGene00001614 Length:836 Species:Caenorhabditis elegans


Alignment Length:433 Identity:86/433 - (19%)
Similarity:146/433 - (33%) Gaps:112/433 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 KGIPYND--W--TLRLTVAIERSHCETFIAFQEQIPEFARYFYHASIYSIWRS---LRNRFMFVY 135
            ||:||..  |  ||||.:...:|         .||.:..|      ..|.|:|   ::.||    
 Worm   289 KGVPYTTSIWIDTLRLLIRSMKS---------IQIWDEPR------CGSSWKSGSDIKKRF---- 334

  Fly   136 TKEFEDKKDSYLSGYIFQDQPNILVITSQYLNSSTFEIKTNRFVGPRNFNKNPEPVEFYIL---- 196
               ||:.    |:|                       |..:....|.....|      |.|    
 Worm   335 ---FENP----LAG-----------------------ISGDLHWAPSGERSN------YTLHVYR 363

  Fly   197 -----QRFDAKGTKATWETQS-----------AMSSKMRNLKGREVVIGIFDYKPFMLLDYEKPP 245
                 |:|      |.|.:::           |.||:...|:|:.:.|.::...||:::      
 Worm   364 RTLSFQKF------AEWSSRTRRIASSEAVVIANSSEKLTLEGKHLKISVYLEAPFVMI------ 416

  Fly   246 LYYDRFMNTTDVTIDGTDIQLMLIFCELYNCTIQVDTSEPYDWGDIYLNASGYGLVGMILDRRND 310
                    |::.:.:|..|.|:.....:...|..:.......:|....|....|:||.:.....|
 Worm   417 --------TSNGSYEGYCIDLLHKIANILKFTYTIQKVRDNAYGSKESNGKWSGMVGELQRGDAD 473

  Fly   311 YGVGGMYLWYEAYEYMDMTHFLGRSGVTCLVPAPN-RLISWTLLLRPFQFVLWMCVMLCLLLESL 374
            ..|..:.:.|...|.:|.|......|::.|...|. |...|...:.|....:|:.......:.|:
 Worm   474 LAVASLTISYGRSEVIDFTVPYMHLGISILFKKPRIRDSDWFKFMDPLSTQVWIMTFASYFVVSV 538

  Fly   375 ALGITRR---WEHSSVAAGNSWIS------SLRFGCISTLKLFVNQSTNYVTSSYALRTVLVASY 430
            |:.|..:   :|.......|....      |||.....|:...:.|.:.....:.:.|.:....:
 Worm   539 AIWIIAKISPYEQFERDEDNGQYKPVDNQFSLRNSFWFTVCSLMQQGSELCPRAASTRLLTGIWW 603

  Fly   431 MIDIILTTVYSGGLAAILTLPTLEEAADSRQRLFDHKLIWTGT 473
            ...:||.:.|:..|||:||...:|...::...|.....|..||
 Worm   604 FFALILISSYTANLAAVLTTRRMETPIENADDLAAQTKIKYGT 646

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir76aNP_001097647.3 None
glr-3NP_492017.3 PBP1_iGluR_non_NMDA-like 21..385 CDD:380591 31/156 (20%)
Periplasmic_Binding_Protein_Type_2 401..761 CDD:419667 50/260 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.