DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir76a and Grin3b

DIOPT Version :9

Sequence 1:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_579842.2 Gene:Grin3b / 170796 RGDID:621705 Length:1002 Species:Rattus norvegicus


Alignment Length:401 Identity:85/401 - (21%)
Similarity:146/401 - (36%) Gaps:122/401 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   299 GLVGMILDRRNDYGVGGMYLWYEAYEYMDMTH-FLGRS-GV---TCLVPAPNRLISWTLLLRPFQ 358
            ||||.:|..|....|....:.....:.:|.|. |...| |:   |....:|.....|     |..
  Rat   515 GLVGDLLAGRAHMAVTSFSINSARSQVVDFTSPFFSTSLGIMVRTRDTASPIGAFMW-----PLH 574

  Fly   359 FVLWMCVMLCLLLESLAL---------GITRRWEHSSVAAGNSWISSLR------FGCISTLKLF 408
            :.:|:.|...|.|.:|.|         |:|.|..:.....  |:.|:|.      ||...:.|..
  Rat   575 WSMWVGVFAALHLTALFLTLYEWRSPYGLTPRGRNRGTVF--SYSSALNLCYAILFGRTVSSKTP 637

  Fly   409 VNQSTNYVTSSYALRTVLVASYMIDIILTTVYSGGLAAILT-LPTLEEAADSRQRLFDHKL---- 468
            ...:..::.:.:|:..:||.|         .|:..|||::. ..|.||.:.    :.|.||    
  Rat   638 KCPTGRFLMNLWAIFCLLVLS---------SYTANLAAVMVGDKTFEELSG----IHDPKLHHPS 689

  Fly   469 -------IWTGTSQAWI-TTIDERSADPVLLGLMEHYRVYDANLISAFSHTEQMGFVVERLQFGH 525
                   :|..:::|:| .:..|..|         |.|.:.|       .|...|          
  Rat   690 QGFRFGTVWESSAEAYIKASFPEMHA---------HMRRHSA-------PTTPHG---------- 728

  Fly   526 LGNTELIENDALKRLKLMVDDIYFAFTVAF---------------------VPRLWPHLNAYNDF 569
               ..::.:|..|....::|.....:.|:.                     :|:..|..:..::|
  Rat   729 ---VAMLTSDPPKLNAFIMDKSLLDYEVSIDADCKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEF 790

  Fly   570 ILAWHSSGF-----DKFWEWKIAAEYMNAHRQNRIVASEKTNLDIGPVKLGIDNFIGLILLWCFG 629
            |..:.||||     ||:::.....:        |:.|..:|      :::|:.:|.||.:|.|.|
  Rat   791 ISRYKSSGFIDLLHDKWYKMVPCGK--------RVFAVTET------LQMGVYHFSGLFVLLCLG 841

  Fly   630 MICSLLTFLGE 640
            :..:|||.|||
  Rat   842 LGSALLTSLGE 852

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir76aNP_001097647.3 None
Grin3bNP_579842.2 PBP1_iGluR_NMDA_NR3 21..405 CDD:107372
PBP2_iGluR_NMDA_Nr3 414..808 CDD:270438 69/341 (20%)
Lig_chan 576..842 CDD:278489 62/323 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 882..910
Involved in the trafficking and surface expression of NMDARs. /evidence=ECO:0000250 951..984
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350128
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.