DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir76a and Gria2

DIOPT Version :9

Sequence 1:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_001344853.2 Gene:Gria2 / 14800 MGIID:95809 Length:901 Species:Mus musculus


Alignment Length:497 Identity:97/497 - (19%)
Similarity:178/497 - (35%) Gaps:117/497 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 ANRSDQDVYDY-------------KIKEDEFEGKGIPYNDWTLRLTVAIERSHCETFIAFQEQIP 109
            ||.|...:.||             .::|.|:.|.......:|..||....:...|.|...::|..
Mouse   255 ANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLRKQRI 319

  Fly   110 EFARYFYHASIYS-----------IWRSLRNRFMFVYTKEFEDKKDSYLSGYIFQDQPNILVITS 163
            |.:|........:           |.|:|:.       .:.|.     |||.|..||      ..
Mouse   320 EISRRGNAGDCLANPAVPWGQGVEIERALKQ-------VQVEG-----LSGNIKFDQ------NG 366

  Fly   164 QYLN--SSTFEIKTNRFVGPRNFNKNPEPVEFYILQRFDAKGTKATWETQSAMSSKMRNLKGREV 226
            :.:|  .:..|:|||   |||......|..:..:..            |:....:....|:.:.|
Mouse   367 KRINYTINIMELKTN---GPRKIGYWSEVDKMVVTL------------TELPSGNDTSGLENKTV 416

  Fly   227 VIGIFDYKPFMLLDYEKPPL----YYDRFMNTTDVTID-----GTDIQLMLIFCELYNCTIQVDT 282
            |:......|::::......|    .|:.:  ..|:..:     |...:|.::....|... ..||
Mouse   417 VVTTILESPYVMMKKNHEMLEGNERYEGY--CVDLAAEIAKHCGFKYKLTIVGDGKYGAR-DADT 478

  Fly   283 SEPYDWGDIYLNASGYGLVGMILDRRNDYGVGGMYLWYEAYEYMDMTHFLGRSGVTCLVPAPNR- 346
            .   .|.         |:||.::..:.|..:..:.:.....|.:|.:......|::.::..|.: 
Mouse   479 K---IWN---------GMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKS 531

  Fly   347 ---LISWTLLLRPFQFVLWMCVMLCLLLESLALGITRR-----WEHSSVAAG---NSWISSLRFG 400
               :.|:   |.|..:.:|||::...:..|:.|.:..|     |.......|   .|..|:..||
Mouse   532 KPGVFSF---LDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFG 593

  Fly   401 CIS----TLKLFVNQSTNYVTSSYALRTVLVASYMIDIILTTVYSGGLAAILT----LPTLEEAA 457
            ..:    :|..|:.|..:....|.:.|.|....:...:|:.:.|:..|||.||    :..:|.|.
Mouse   594 IFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAE 658

  Fly   458 D-SRQRLFDHKLIWTGTSQAW-----ITTIDE-----RSADP 488
            | |:|....:..:.:|:::.:     |...|:     |||:|
Mouse   659 DLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEP 700

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir76aNP_001097647.3 None
Gria2NP_001344853.2 PBP1_iGluR_AMPA_GluR2 28..398 CDD:380612 35/163 (21%)
PBP2_iGluR_AMPA 413..794 CDD:270433 60/306 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846634
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.