DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir76a and GRIN3A

DIOPT Version :9

Sequence 1:NP_001097647.3 Gene:Ir76a / 40157 FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster
Sequence 2:NP_597702.2 Gene:GRIN3A / 116443 HGNCID:16767 Length:1115 Species:Homo sapiens


Alignment Length:637 Identity:120/637 - (18%)
Similarity:209/637 - (32%) Gaps:242/637 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 QPNILVITS---------------QYLN-----------SSTFEIKTNRFVGPRNFNKNPEPVEF 193
            ||.:.:|.|               |||:           |.:..:|.:..|...|        .|
Human   407 QPELALIPSTMNCMEVETTNLTSGQYLSRFLANTTFRGLSGSIRVKGSTIVSSEN--------NF 463

  Fly   194 YI--LQRFDAKGTKATWETQSAMSSKMRNLKGREVVI--GIFD-----YKPFMLLDYEKPPLYYD 249
            :|  ||. |..| |..|       :::.:.:|.::|:  ||:.     :|    ..::.|...:.
Human   464 FIWNLQH-DPMG-KPMW-------TRLGSWQGGKIVMDYGIWPEQAQRHK----THFQHPSKLHL 515

  Fly   250 R--------FMNTTDVTIDG--TDIQLML------------IFCELY--NCTIQ----------- 279
            |        |:.|.:|..:|  ...||.|            :|..|:  |.|:.           
Human   516 RVVTLIEHPFVFTREVDDEGLCPAGQLCLDPMTNDSSTLDSLFSSLHSSNDTVPIKFKKCCYGYC 580

  Fly   280 VDTSEP------YDWGDIYL----------NASGYGLVGMILDRRNDYGVGGMYLWYEAYEYMDM 328
            :|..|.      :|: |:|:          |....||||.:|.......|....:.....:.:|.
Human   581 IDLLEKIAEDMNFDF-DLYIVGDGKYGAWKNGHWTGLVGDLLRGTAHMAVTSFSINTARSQVIDF 644

  Fly   329 THFLGRSGVTCLV-----PAPNRLISWTLLLRPFQFVLWMCVMLCLLLESLAL---------GIT 379
            |.....:.:..||     .||.....|     |..:.:|:.:.:.|.:.::.|         |:|
Human   645 TSPFFSTSLGILVRTRDTAAPIGAFMW-----PLHWTMWLGIFVALHITAVFLTLYEWKSPFGLT 704

  Fly   380 RRWEHSSVAAGNSWISSLRFGCISTLKLFVNQSTNYVTSSYAL---RTVLV-------ASYMIDI 434
            .:..:.|                   |:|...|.  :...|||   |||.:       ..:::::
Human   705 PKGRNRS-------------------KVFSFSSA--LNICYALLFGRTVAIKPPKCWTGRFLMNL 748

  Fly   435 ------ILTTVYSGGLAAILTLPTLEEAADSRQRLFDHKLIWTGTSQAW-ITTIDERSAD----- 487
                  ...:.|:..|||::   ..|:..:....:.|.||  ...||.: ..|:.|.||:     
Human   749 WAIFCMFCLSTYTANLAAVM---VGEKIYEELSGIHDPKL--HHPSQGFRFGTVRESSAEDYVRQ 808

  Fly   488 --PVLLGLMEHYRVYDANLISAFSHTEQMGFVVERLQFGHLGNTELIENDALKRLKLMVDDIYFA 550
              |.:...|..|.|....                       ...|.::||..|....::|.....
Human   809 SFPEMHEYMRRYNVPATP-----------------------DGVEYLKNDPEKLDAFIMDKALLD 850

  Fly   551 FTVAF---------------------VPRLWPHLNAYNDFILAWHSSGF-----DKFWEWKIAAE 589
            :.|:.                     :|...|.....::.|..:.|.||     ||::       
Human   851 YEVSIDADCKLLTVGKPFAIEGYGIGLPPNSPLTANISELISQYKSHGFMDMLHDKWY------- 908

  Fly   590 YMNAHRQNRIVASEKTNLDI-GPVKLGIDNFIGLILLWCFGMICSLLTFLGE 640
                    |:|...|.:..: ..:::||.:|.||.:|.|.|...|:||.:||
Human   909 --------RVVPCGKRSFAVTETLQMGIKHFSGLFVLLCIGFGLSILTTIGE 952

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir76aNP_001097647.3 None
GRIN3ANP_597702.2 PBP1_iGluR_NMDA_NR3 30..497 CDD:107372 23/106 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..118
ANF_receptor 127..469 CDD:279440 13/69 (19%)
PBP2_iGluR_NMDA_Nr3 512..908 CDD:270438 79/450 (18%)
Lig_chan 676..942 CDD:278489 57/329 (17%)
PPP2CB binding site. /evidence=ECO:0000250 951..987 2/2 (100%)
GIT1-binding. /evidence=ECO:0000250|UniProtKB:Q9R1M7 1062..1095
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156091
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.