DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14102 and CG44006

DIOPT Version :9

Sequence 1:NP_649147.2 Gene:CG14102 / 40156 FlyBaseID:FBgn0036906 Length:441 Species:Drosophila melanogaster
Sequence 2:NP_001262002.1 Gene:CG44006 / 14462878 FlyBaseID:FBgn0264748 Length:374 Species:Drosophila melanogaster


Alignment Length:370 Identity:74/370 - (20%)
Similarity:137/370 - (37%) Gaps:105/370 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DLNYDCYHQIFSYINVLEDQLNLGRAHPLFQVVLTDILRTRHKKINVRLLKTIPDWEFLLQLCGS 92
            ||..:....||..:..|.|::.|.:.|...........|:..||::.....|...|..::.||||
  Fly     9 DLPIEVLDLIFVELQSLVDKVQLAQVHEKLGKAFAYHSRSAFKKLSPFFGVTQELWLVIVSLCGS 73

  Fly    93 ---EVSRCEVPHGSWDEPFTYPFLGLLGRHCPKLRQAVI-IFMHAVTESPPKSGDRGHIMQLLLE 153
               |.|..::    |:.|::...:..:.:||..|:...| :|          ..:...:...||:
  Fly    74 TVEEFSSRQI----WNTPWSDILVESIEQHCTNLKSVRIDVF----------ENNCDGVRSFLLK 124

  Fly   154 LPSLTNLTLIDARSAQLDQLRHFSKLEALDLDGIDPNLSNASFQQMFES---MASLKRLLLNFGP 215
            :..|    |:.|      :|..|:|         ||       :::|:|   ||::.:|.|    
  Fly   125 MSKL----LVSA------ELTIFTK---------DP-------KKLFDSVAEMANVTQLAL---- 159

  Fly   216 DRRRSHQVPLLADKFPNLDHLTLENFDMSFPELGEFKGLRSLRLISRWTAEVDNDFYRSVAKRVS 280
             |....:......|...|:.|.:: ::.||   ..|..|..|.:.:..|                
  Fly   160 -RGNITEDVCQIQKLTALEELVID-YNKSF---NPFLPLNLLEICTPLT---------------- 203

  Fly   281 NLQKLQLISVR-VRGDQVHHILAIRQLNALDCDNWPAQSVSQLGQLKDLEC-LALDCIDSPANPS 343
            ||:.|.:.::. :..:|.|.::            ||     :|..||..:| :..:..|.|  ..
  Fly   204 NLRSLTVRNITIIPSEQPHPLI------------WP-----KLEDLKINDCEIITELPDCP--KL 249

  Fly   344 RQLMLLVQNCY------------NLNHLRLGKHWKMPIEDVNQFL 376
            :.|.::..|||            .:|..::.::...|..|.:.||
  Fly   250 KTLDMINSNCYIEGLLFGFILQNGVNIKKMNENSNPPPFDGDNFL 294



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.