DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SREBP and TYE7

DIOPT Version :9

Sequence 1:NP_001262064.1 Gene:SREBP / 40155 FlyBaseID:FBgn0261283 Length:1113 Species:Drosophila melanogaster
Sequence 2:NP_014989.3 Gene:TYE7 / 854525 SGDID:S000005871 Length:291 Species:Saccharomyces cerevisiae


Alignment Length:267 Identity:59/267 - (22%)
Similarity:107/267 - (40%) Gaps:90/267 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 GSSFVYQSMSPPTSPVESANQNV------NVMQPVAATPAPASAPLPQQSYPQPFITYNSKAGMT 217
            |:|.:  :::..:|.|.||:.:.      |::.  :|:.:...:|:..|     ||:.|      
Yeast    33 GASHI--NVNKDSSSVLSASSSTWFEPLENIIS--SASSSSIGSPIEDQ-----FISSN------ 82

  Fly   218 SDEAMYFLLQPTVASPTPSPPVAPPPTSTGSRASKVRVAPLAP-SPAAME--------------- 266
            ::|:..|......::|: |...:|..:|:..|........||. .||:::               
Yeast    83 NEESALFPTDQFFSNPS-SYSHSPEVSSSIKREEDDNALSLADFEPASLQLMPNMINTDNNDDST 146

  Fly   267 -VQGKVPIN----RVQPKVKEVK------------RSAHNAIERRYRTSINDKINELKNLV---- 310
             ::.::.:|    :.....||.|            :.|||.||:|||.:||.||..|:.::    
Yeast   147 PLKNEIELNDSFIKTNLDAKETKKRAPRKRLTPFQKQAHNKIEKRYRININTKIARLQQIIPWVA 211

  Fly   311 -------VGE------------------------QAKLNKSAVLRKSIDKIRDLQRQNHDLKAEL 344
                   ||:                        ..|||||.:|.|::|.|..||......:.|:
Yeast   212 SEQTAFEVGDSVKKQDEDGAETAATTPLPSAAATSTKLNKSMILEKAVDYILYLQNNERLYEMEV 276

  Fly   345 QRLQREL 351
            |||:.|:
Yeast   277 QRLKSEI 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SREBPNP_001262064.1 HLH 281..338 CDD:238036 29/103 (28%)
OmpH <289..>364 CDD:281871 29/98 (30%)
TYE7NP_014989.3 bHLHzip_SREBP_like 179..283 CDD:381401 30/103 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2588
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001476
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.