DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SREBP and HMS1

DIOPT Version :9

Sequence 1:NP_001262064.1 Gene:SREBP / 40155 FlyBaseID:FBgn0261283 Length:1113 Species:Drosophila melanogaster
Sequence 2:NP_014675.1 Gene:HMS1 / 854197 SGDID:S000005558 Length:434 Species:Saccharomyces cerevisiae


Alignment Length:394 Identity:84/394 - (21%)
Similarity:140/394 - (35%) Gaps:129/394 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 SYNCPQQQPTGLLKAAQP-------TATIHHMDAQRMPPNTAVYPPSLGSSFVYQSM-SPPTSPV 174
            :|..|.|.|..|.....|       :||..:.|:..  |||:.:.|.:.|::...:: |.||:..
Yeast    81 AYYAPFQHPIHLQPPVPPVYKNNTYSATDQYSDSSF--PNTSGHTPVIDSNYYNDALASIPTTTT 143

  Fly   175 ESA--------------------------NQNV-NVMQPVAATPAPASAPLPQQSYPQPFITYNS 212
            .|.                          |:|: ||.|....:...:|              ..|
Yeast   144 GSTTMTTDNGNTIDSEEYIDNMEVFSSEENENIDNVKQTDLKSEKDSS--------------LLS 194

  Fly   213 KAGMTSDEAMYFLLQPTVASPTPSPPVAPPPTSTGSRASKVRVAPLAPSPAAMEVQGKV-PINR- 275
            .|.:...|.:.........|.|.||.|......:......:..|.      :|..:.|. ||.: 
Yeast   195 AASIVKKEQLSGFENFLPLSKTESPLVTADEIKSSLNLENIDNAD------SMSFKLKTSPIRKH 253

  Fly   276 --VQPK-VKEVK--RSAHNAIERRYRTSINDKINELKNLV------------------------- 310
              |:|| :..|:  |.:||.||::||::|||||.:|:..|                         
Yeast   254 FHVKPKRITRVRTGRVSHNIIEKKYRSNINDKIEQLRRTVPTLRVAYKKCNDLPITSRDLADLDG 318

  Fly   311 VGEQAKLNKSAVLRKSIDKIRDLQRQNHDLKAELQRLQRELMARDG-------------SKVKDL 362
            :....||||:::|.|||:.|..|:|:...|....|.|..:  .||.             :...:.
Yeast   319 LEPATKLNKASILTKSIEYICHLERKCLQLSLANQHLSND--TRDSFVHLTEPSQPLSDNSSSEQ 381

  Fly   363 LQLGTRPGRASKKRRESSQTFTTDAGLTPPRSDESDPSLSPMHSDISLPPSPYGGSTASCSSGSS 427
            :|..||..:..::|:              ||..:      |:|:.....|...|     ..||::
Yeast   382 VQKQTRSCQRQRQRQ--------------PRQQQ------PLHNIQYNIPHQNG-----LMSGTN 421

  Fly   428 SSNE 431
            :|::
Yeast   422 NSHD 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SREBPNP_001262064.1 HLH 281..338 CDD:238036 26/83 (31%)
OmpH <289..>364 CDD:281871 28/112 (25%)
HMS1NP_014675.1 bHLHzip_scHMS1_like 265..363 CDD:381405 30/99 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345454
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2588
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001476
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1708
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.