DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SREBP and BIM2

DIOPT Version :9

Sequence 1:NP_001262064.1 Gene:SREBP / 40155 FlyBaseID:FBgn0261283 Length:1113 Species:Drosophila melanogaster
Sequence 2:NP_177064.1 Gene:BIM2 / 843233 AraportID:AT1G69010 Length:311 Species:Arabidopsis thaliana


Alignment Length:285 Identity:64/285 - (22%)
Similarity:99/285 - (34%) Gaps:95/285 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 RSAHNAIERRYRTSINDKINELKNLVVGEQAKLNKSAVLRKSIDKIRDLQ--------------- 334
            ||.|:..|:|.|:.||::...|:.|:...:.|.:.::.|.:.||.::.||               
plant    47 RSKHSVTEQRRRSKINERFQILRELIPNSEQKRDTASFLLEVIDYVQYLQEKVQKYEGSYPGWSQ 111

  Fly   335 --------RQNHDLKAELQRLQRELMARDGSKVKDLLQLGTRPGRASKKRRESSQTFTTDAGLTP 391
                    |.||   ..:|.|....:|         :..|:.||.....:.|.:...:|.|.:..
plant   112 EPTKLTPWRNNH---WRVQSLGNHPVA---------INNGSGPGIPFPGKFEDNTVTSTPAIIAE 164

  Fly   392 PR--------------SDESDPSLSPMHSDISLPP-SP-----YGGSTASC---SSGSSSSNEEP 433
            |:              |.||.|.|    .|..||| .|     .|.....|   |.|...||:  
plant   165 PQIPIESDKARAITGISIESQPEL----DDKGLPPLQPILPMVQGEQANECPATSDGLGQSND-- 223

  Fly   434 LVVPS---SMRGMATHSRLGLCMFMFAILAVNPFKTFLQRGHYDSND-------DLGDMSGQ--- 485
            ||:..   |:....:|..|            :.....||....|.:.       |||..:.|   
plant   224 LVIEGGTISISSAYSHELL------------SSLTQALQNAGIDLSQAKLSVQIDLGKRANQGLT 276

  Fly   486 ------RRILSYDVEGEGFAVWQQS 504
                  :..||||.:|...:|.::|
plant   277 HEEPSSKNPLSYDTQGRDSSVEEES 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SREBPNP_001262064.1 HLH 281..338 CDD:238036 17/75 (23%)
OmpH <289..>364 CDD:281871 19/97 (20%)
BIM2NP_177064.1 HLH 47..100 CDD:238036 16/52 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001476
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.