DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SREBP and GL3

DIOPT Version :9

Sequence 1:NP_001262064.1 Gene:SREBP / 40155 FlyBaseID:FBgn0261283 Length:1113 Species:Drosophila melanogaster
Sequence 2:NP_001332706.1 Gene:GL3 / 834133 AraportID:AT5G41315 Length:645 Species:Arabidopsis thaliana


Alignment Length:312 Identity:53/312 - (16%)
Similarity:111/312 - (35%) Gaps:92/312 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 IATSYNCPQQQPTGLLKAAQPTATI------HHMDAQRMPP---NTAVYPPSLGS---------- 160
            |....|..|...|..|:|..|.|||      :|:|....|.   ...:|.|...:          
plant   200 ITEDMNVIQCVKTSFLEAPDPYATILPARSDYHIDNVLDPQQILGDEIYAPMFSTEPFPTASPSR 264

  Fly   161 -----------------SFVYQSMSPPTSPVES-----------ANQNVNVMQPVAATPAPASA- 196
                             ||:.:.::...|.|:|           .:|::|....|:.|....:| 
plant   265 TTNGFDQEHEQVADDHDSFMTERITGGASQVQSWQLMDDELSNCVHQSLNSSDCVSQTFVEGAAG 329

  Fly   197 ---------------PLPQQSYPQPFITYNSKAGMTSDEAMYFLLQPTVASPTPSPPVAPPPTST 246
                           .:.:|......::::.:    :|:..|..:..|:........:.|...:.
plant   330 RVAYGARKSRVQRLGQIQEQQRNVKTLSFDPR----NDDVHYQSVISTIFKTNHQLILGPQFRNC 390

  Fly   247 GSRASKVR-----------VAPLAPSPAAMEVQGKV--PINRVQPKVKEVKRSA--------HNA 290
            ..::|..|           ....|||...::   |:  .:.||..|.|.:..|.        |..
plant   391 DKQSSFTRWKKSSSSSSGTATVTAPSQGMLK---KIIFDVPRVHQKEKLMLDSPEARDETGNHAV 452

  Fly   291 IERRYRTSINDKINELKNLVVGEQAKLNKSAVLRKSIDKIRDLQRQNHDLKA 342
            :|::.|..:|::...|:.::.... |::|.::|..:|:.:::|:|:..:|::
plant   453 LEKKRREKLNERFMTLRKIIPSIN-KIDKVSILDDTIEYLQELERRVQELES 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SREBPNP_001262064.1 HLH 281..338 CDD:238036 13/64 (20%)
OmpH <289..>364 CDD:281871 11/54 (20%)
GL3NP_001332706.1 bHLH-MYC_N 22..214 CDD:372964 4/13 (31%)
bHLH_AtTT8_like 445..519 CDD:381457 12/60 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.