DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SREBP and AT4G16430

DIOPT Version :9

Sequence 1:NP_001262064.1 Gene:SREBP / 40155 FlyBaseID:FBgn0261283 Length:1113 Species:Drosophila melanogaster
Sequence 2:NP_193376.1 Gene:AT4G16430 / 827337 AraportID:AT4G16430 Length:467 Species:Arabidopsis thaliana


Alignment Length:189 Identity:38/189 - (20%)
Similarity:69/189 - (36%) Gaps:77/189 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 QGKVPINRVQPKVKEVKRSAHNAIERRYRTSINDKINELKNLVVGEQAKLNKSAVLRKSIDKIRD 332
            :|:.|.|..:..:..|:      .||:.|..:|.:...|: .||...:|::|:::|..:|..|.|
plant   307 RGRKPANGREEALNHVE------AERQRREKLNQRFYALR-AVVPNISKMDKASLLADAITYITD 364

  Fly   333 LQRQNHDLKAELQRLQRELMARDGSKVKDLLQLGTRPGRASKKRRESSQTFTTDAGLTPPRSD-- 395
            :|:     |..:...::::|                      |||||:|       :||...|  
plant   365 MQK-----KIRVYETEKQIM----------------------KRRESNQ-------ITPAEVDYQ 395

  Fly   396 --------------ESDP-----------SLSPMHSDISLPPS---------PYGGSTA 420
                          |:.|           .:.|..|::::...         |.||.||
plant   396 QRHDDAVVRLSCPLETHPVSKVIQTLRENEVMPHDSNVAITEEGVVHTFTLRPQGGCTA 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SREBPNP_001262064.1 HLH 281..338 CDD:238036 15/56 (27%)
OmpH <289..>364 CDD:281871 16/74 (22%)
AT4G16430NP_193376.1 bHLH-MYC_N 50..226 CDD:372964
bHLH_AtAIB_like 313..390 CDD:381455 25/117 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.