DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SREBP and PIL5

DIOPT Version :9

Sequence 1:NP_001262064.1 Gene:SREBP / 40155 FlyBaseID:FBgn0261283 Length:1113 Species:Drosophila melanogaster
Sequence 2:NP_001189559.1 Gene:PIL5 / 816538 AraportID:AT2G20180 Length:478 Species:Arabidopsis thaliana


Alignment Length:461 Identity:95/461 - (20%)
Similarity:160/461 - (34%) Gaps:143/461 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 QQPHVKSEHSSPVHIKEELHQQQQQSP---LLVYKPD-------PLIATSYNCPQQQPTGLLKAA 133
            |:.|.|...|||..:...:..|||.|.   |.:.:.:       ||....: |     :.||.:|
plant    54 QRLHTKKPSSSPPKLLPSMDPQQQPSSDQNLFIQEDEMTSWLHYPLRDDDF-C-----SDLLFSA 112

  Fly   134 QP----TATIHHMDAQRMP---PNTAVYP-----------------------PSLGSSFVYQS-- 166
            .|    |||:..:.|.|.|   .|.:..|                       |.|..:.|.:|  
plant   113 APTATATATVSQVTAARPPVSSTNESRPPVRNFMNFSRLRGDFNNGRGGESGPLLSKAVVRESTQ 177

  Fly   167 MSPPTSPVESANQNVNVMQPVAATPAPASAPLPQQSYPQPFITYNSKAGMTSDEAMYFLLQPTVA 231
            :||..:|..:|::: .:.:....|.:.|.|...         .||.|....:..|....:..|.:
plant   178 VSPSATPSAAASES-GLTRRTDGTDSSAVAGGG---------AYNRKGKAVAMTAPAIEITGTSS 232

  Fly   232 SPTPSPPVAPPPTSTGSRASKVRVAPLAPSPAAMEVQGKVPINRVQPKVKEVKRS----AHNAIE 292
            |......:.|..|:...|..|.|.|.......:...:.|    :.:......|||    .||..|
plant   233 SVVSKSEIEPEKTNVDDRKRKEREATTTDETESRSEETK----QARVSTTSTKRSRAAEVHNLSE 293

  Fly   293 RRYRTSINDKINELKNLVVGEQAKLNKSAVLRKSIDKIRDLQRQNHDLKAELQRLQRELMARDGS 357
            |:.|..||:::..|:.| :....|.:|:::|.::|:.::.||            ||.::|:    
plant   294 RKRRDRINERMKALQEL-IPRCNKSDKASMLDEAIEYMKSLQ------------LQIQMMS---- 341

  Fly   358 KVKDLLQLGTRPGRASKKRRESSQTFTTDAGLTP---PRSDESDPSLS---PMHSDISLPPS--P 414
                   :|                    .|:.|   |...:..|.::   .|:..|. |||  |
plant   342 -------MG--------------------CGMMPMMYPGMQQYMPHMAMGMGMNQPIP-PPSFMP 378

  Fly   415 YGGSTASCSSGSSSSNEEPLVVPSSMRGMATHSRLGLCMFMFAILAVNPFKTFLQRGHYDSNDDL 479
            :....|:         :.||...:.|.|...         .:.:.|.:|.:.|:....||..   
plant   379 FPNMLAA---------QRPLPTQTHMAGSGP---------QYPVHASDPSRVFVPNQQYDPT--- 422

  Fly   480 GDMSGQ 485
               |||
plant   423 ---SGQ 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SREBPNP_001262064.1 HLH 281..338 CDD:238036 18/60 (30%)
OmpH <289..>364 CDD:281871 17/74 (23%)
PIL5NP_001189559.1 HLH 290..338 CDD:197674 16/60 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.