DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SREBP and USF2

DIOPT Version :9

Sequence 1:NP_001262064.1 Gene:SREBP / 40155 FlyBaseID:FBgn0261283 Length:1113 Species:Drosophila melanogaster
Sequence 2:XP_024307452.1 Gene:USF2 / 7392 HGNCID:12594 Length:397 Species:Homo sapiens


Alignment Length:259 Identity:55/259 - (21%)
Similarity:84/259 - (32%) Gaps:95/259 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 PVAAT--PAPASAPLPQQSYPQPFITYNSKAG-MTSDEAMYFLLQPTVASPTPSPPVAPPPTS-- 245
            |.||:  |.|| ||.|......||....|.|. ..|.||.:.....:....|.:..|.....|  
Human   128 PAAASVPPGPA-APFPLAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTAVSVQTTDQSLQ 191

  Fly   246 ----------------TGS-RASKVRVAPLAPSPAAMEVQGKVPINRVQPKVKEVKRSAHNAIER 293
                            ||: |....|..|.:|.           |:..:....|.:|:.||.:||
Human   192 AGGQFYVMMTPQDVLQTGTQRTIAPRTHPYSPK-----------IDGTRTPRDERRRAQHNEVER 245

  Fly   294 RYRTSINDKINELKNLV------------------------------------------------ 310
            |.|..||:.|.:|..::                                                
Human   246 RRRDKINNWIVQLSKIIPDCNADNSKTGAVSTPDPQCLRWSRPPTLACRKSNSHGARESSLGWRP 310

  Fly   311 --------VGEQAKLNKSAVLRKSIDKIRDLQRQNHDLK---AELQRLQ--RELMARDGSKVKD 361
                    .|..|..:|..:|.|:.|.||:|::.|..::   .|.:|||  .||:.:...::|:
Human   311 VGGACPKAPGPLAPQSKGGILSKACDYIRELRQTNQRMQETFKEAERLQMDNELLRQQIEELKN 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SREBPNP_001262064.1 HLH 281..338 CDD:238036 21/112 (19%)
OmpH <289..>364 CDD:281871 26/134 (19%)
USF2XP_024307452.1 HLH 233..346 CDD:238036 21/112 (19%)
ZapB 341..>385 CDD:310531 9/34 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1708
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.