DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SREBP and tfec

DIOPT Version :9

Sequence 1:NP_001262064.1 Gene:SREBP / 40155 FlyBaseID:FBgn0261283 Length:1113 Species:Drosophila melanogaster
Sequence 2:NP_001025276.2 Gene:tfec / 556894 ZFINID:ZDB-GENE-041210-21 Length:396 Species:Danio rerio


Alignment Length:332 Identity:72/332 - (21%)
Similarity:121/332 - (36%) Gaps:89/332 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 SPVESANQNVNVMQ------------PVAATPAPASAPLPQQSYPQPFITYNSKAGMTSDEAMYF 224
            |.:|::..::|..|            .:|:...|.:.|||.|:.....:..|......||     
Zfish    23 SHLENSKYHLNQTQAQQVKQYLALGSKLASQAHPVAHPLPGQALGTVPVMRNGHMPPVSD----- 82

  Fly   225 LLQPTVASPTPSPPVAPPPTSTGSRASKVRVAPLAPSPAAME----------------VQGKVPI 273
                   |.||..||. ..|...:..|:..:..:......:|                :|..|.:
Zfish    83 -------SSTPGSPVT-LLTLANNHDSEFPMDEVIDDLIGLENGFKDGSLDCMEPGIIMQNNVSL 139

  Fly   274 N---------------RVQPKVKEVKRSAHNAIERRYRTSINDKINELKNLVV---GEQAKLNKS 320
            |               ||..|.:: |:..||.||||.|.:||.:|.||..|:.   ....:.||.
Zfish   140 NSSMLEVYGADQEHDTRVLAKERQ-KKDNHNLIERRRRYNINYRIKELGTLIPKSNDPDMRWNKG 203

  Fly   321 AVLRKSIDKIRDLQR-QNH--DLKAELQRLQR------------ELMARDGSKVKDLLQLGTRPG 370
            .:|:.|::.|:.||: |.|  ||::..::|::            |:.|...........:||...
Zfish   204 TILKASVEYIKWLQKEQQHARDLESRQKKLEQANRRLQLRIQELEIQAHAHGLPSMTASMGTVEL 268

  Fly   371 RASKKRRESSQTFTTDAGLTPPRSDESDPSLSPMHSDISLP--------PSPYGGSTASCSSGSS 427
            .:...:::..||..|.|..:......:.|.:.|... :|.|        ||..|.     .|..|
Zfish   269 SSHLLKQQHHQTQATAASQSAQAPQSTQPPIYPQEG-VSSPEYTQRTSLPSIVGE-----QSDGS 327

  Fly   428 SSNEEPL 434
            ::..:||
Zfish   328 NNFSDPL 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SREBPNP_001262064.1 HLH 281..338 CDD:238036 22/60 (37%)
OmpH <289..>364 CDD:281871 26/92 (28%)
tfecNP_001025276.2 MITF_TFEB_C_3_N <17..109 CDD:292573 20/98 (20%)
HLH 161..221 CDD:238036 21/60 (35%)
Ax_dynein_light <204..>251 CDD:287215 11/46 (24%)
DUF3371 249..377 CDD:288684 18/92 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.