DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SREBP and MITF

DIOPT Version :9

Sequence 1:NP_001262064.1 Gene:SREBP / 40155 FlyBaseID:FBgn0261283 Length:1113 Species:Drosophila melanogaster
Sequence 2:NP_001341533.1 Gene:MITF / 4286 HGNCID:7105 Length:526 Species:Homo sapiens


Alignment Length:539 Identity:115/539 - (21%)
Similarity:171/539 - (31%) Gaps:200/539 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 DEPRTHTQ------QTQSVDQQPQSVEQQPHVKSEHSSPVHIKEELHQQQQQSPLLVYKPDPLIA 116
            :||:|:.:      ::.|..:.| ...:.|...|..:|.:.::::|.::|.|......:...|.|
Human    19 EEPKTYYELKSQPLKSSSSAEHP-GASKPPISSSSMTSRILLRQQLMREQMQEQERREQQQKLQA 82

  Fly   117 TSY---NCPQQQ--------PTGLLKAAQ--------------PTATIHHMDAQRMPPNTAVYPP 156
            ..:   ..|..|        ||.|..|.|              || ..|...|||......: ..
Human    83 AQFMQQRVPVSQTPAINVSVPTTLPSATQVPMEVLKVQTHLENPT-KYHIQQAQRQQVKQYL-ST 145

  Fly   157 SLGSSFVYQSMSPPTSPVESANQ-NVNVMQPVAATPAPASAPLPQQSYPQPFITYNSKAGMTSDE 220
            :|.:....|.:|.|     ..|| ..:||.||..:.||.|        |...:|.||..   ..|
Human   146 TLANKHANQVLSLP-----CPNQPGDHVMPPVPGSSAPNS--------PMAMLTLNSNC---EKE 194

  Fly   221 AMY-FLLQPTVASPTPSPPVAPPPTSTGSRAS----------------------------KVRVA 256
            ..| |..|....|..|.       .:|.||||                            .:::|
Human   195 GFYKFEEQNRAESECPG-------MNTHSRASCMQMDDVIDDIISLESSYNEEILGLMDPALQMA 252

  Fly   257 PLAP--------------SPAAMEVQGKVPINRVQPKVK--------------------EVKRSA 287
            ...|              .|..:.:....|.|  .|.:|                    ..|:..
Human   253 NTLPVSGNLIDLYGNQGLPPPGLTISNSCPAN--LPNIKRELTACIFPTESEARALAKERQKKDN 315

  Fly   288 HNAIERRYRTSINDKINELKNLVV---GEQAKLNKSAVLRKSIDKIRDLQRQ------------- 336
            ||.||||.|.:|||:|.||..|:.   ....:.||..:|:.|:|.||.|||:             
Human   316 HNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDYIRKLQREQQRAKELENRQKK 380

  Fly   337 ----NHDLKAELQRLQRELMARDGSKV-------------------------KDLLQ-------- 364
                |..|...:|.|:.:..|...|.:                         :||||        
Human   381 LEHANRHLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADLTCT 445

  Fly   365 ---------------LGTRPGRASKKRRESSQTFTTDAGLTPPRSD-ESDPSLSPMHSDISLPPS 413
                           |||        ..|::|.::....:.....| ..|.:|||:.....|..|
Human   446 TTLDLTDGTITFNNNLGT--------GTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSS 502

  Fly   414 PYGGSTASCSSGSSSSNEE 432
            ...|::.:.|..||.|.||
Human   503 VSPGASKTSSRRSSMSMEE 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SREBPNP_001262064.1 HLH 281..338 CDD:238036 26/96 (27%)
OmpH <289..>364 CDD:281871 31/119 (26%)
MITFNP_001341533.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54 7/35 (20%)
MITF_TFEB_C_3_N 56..194 CDD:318217 35/155 (23%)
Transactivation 224..295 7/72 (10%)
HLH 309..369 CDD:238036 25/59 (42%)
Leucine-zipper. /evidence=ECO:0000305|PubMed:24631970 374..395 3/20 (15%)
DUF3371 397..516 CDD:314681 20/126 (16%)
DNA binding regulation 401..431 2/29 (7%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 496..526 9/26 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1708
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.