DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SREBP and usf1l

DIOPT Version :9

Sequence 1:NP_001262064.1 Gene:SREBP / 40155 FlyBaseID:FBgn0261283 Length:1113 Species:Drosophila melanogaster
Sequence 2:NP_998359.1 Gene:usf1l / 406475 ZFINID:ZDB-GENE-040426-2269 Length:283 Species:Danio rerio


Alignment Length:227 Identity:57/227 - (25%)
Similarity:85/227 - (37%) Gaps:36/227 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 GSSFVYQSMSPPTSPVESANQNVNVMQPVAATPAPASAPLPQQSYPQPFITYNSKAGMTSDEAMY 223
            |....|:.:......||........:..|...|....|..|      |.:...|..|.||:...|
Zfish    55 GGQVTYRVIHLADGQVEGHADGAAAVSVVTGFPTATQAATP------PTVMSESVEGETSETQYY 113

  Fly   224 FLLQPTVASPT----------PSPPVAPPPTSTGSRASKVRVAPLAPSPAAMEVQGKVP-INRVQ 277
            :   |...|.|          .:..|...|||.|.     ....::|.......|...| ..||.
Zfish   114 Y---PATLSDTTAGAMVTGLQTADSVLSQPTSAGQ-----LYVMMSPQDVLATTQPSKPGSQRVS 170

  Fly   278 PKVKEVKRSAHNAIERRYRTSINDKINELKNLV--VGEQAKLN--KSAVLRKSIDKIRDLQRQNH 338
            ...|  :|:.||.:|||.|..||..|.:|...:  ....||.|  ||.:|.|:.|.|::|::.|.
Zfish   171 RDDK--RRAQHNEVERRRRDKINQWIVQLSKTIPDCTYDAKNNQSKSGILSKACDYIQELRQSNA 233

  Fly   339 DLKAELQ-----RLQRELMARDGSKVKDLLQL 365
            .|:.||.     |:..:|:.::..:.|...|:
Zfish   234 RLEDELNTADRLRMDNQLLRKEMEEWKSKNQM 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SREBPNP_001262064.1 HLH 281..338 CDD:238036 22/60 (37%)
OmpH <289..>364 CDD:281871 26/83 (31%)
usf1lNP_998359.1 HLH 175..229 CDD:278439 20/53 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1708
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.