DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SREBP and Mitf

DIOPT Version :9

Sequence 1:NP_001262064.1 Gene:SREBP / 40155 FlyBaseID:FBgn0261283 Length:1113 Species:Drosophila melanogaster
Sequence 2:NP_001245436.1 Gene:Mitf / 3885647 FlyBaseID:FBgn0263112 Length:837 Species:Drosophila melanogaster


Alignment Length:484 Identity:104/484 - (21%)
Similarity:174/484 - (35%) Gaps:151/484 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 MDLAP--TQMYNMLLDEPRTHTQQTQSVDQQPQSVEQ--QPHVKSEHSSPVHIKEELHQ--QQQQ 103
            :|:.|  .|:..:|.:..|.|..|.|. :|..|.:.:  :|.:...|:|.:.:......  ..|.
  Fly   270 VDVPPQVLQVSTVLENPTRYHVIQKQK-NQVRQYLSESFKPSMWGSHTSEIKLANNSASTGNLQN 333

  Fly   104 SPLLVYKPDPLIATS-YNCPQQQPTGLLKAAQPTATIHHMDAQRMPPNTAVYPPS-LGSSFVYQS 166
            |.|.....|||..|: :.|...                 :.|:|:.|:....|.| .|.|||   
  Fly   334 SSLQKGICDPLERTNRFGCDSA-----------------VSAKRIMPSDDAMPISPFGGSFV--- 378

  Fly   167 MSPPTSPVESANQNVNVMQPVAATPAPASAPLPQQSYPQPFITYN-SKAGMTSDEAMYFLLQPTV 230
                      ...::|.::|....|....|..|:.::....:..: :.:.::|..:...::....
  Fly   379 ----------RCDDINPIEPTVLRPNSHGAGEPENAHRTAQLGLSKANSSLSSTRSSSGIVNSIR 433

  Fly   231 ASPT------PSPPVAPPPTSTGSRASK-------------------------VRVAPLAPSPAA 264
            .|.|      .|.|::|..:|..:..|:                         ::..|...:.|.
  Fly   434 ISSTSSSLQSTSAPISPSVSSVATSVSEPDDIFDDILQNDSFNFDKNFNSELSIKQEPQNLTDAE 498

  Fly   265 MEVQGKVPINRVQPKVKEVKRSAHNAIERRYRTSINDKINELKNLV---------VGEQAKLNKS 320
            |....|          ...|:..||.||||.|.:|||:|.||..|:         |....:.||.
  Fly   499 MNALAK----------DRQKKDNHNMIERRRRFNINDRIKELGTLLPKGSDAFYEVVRDIRPNKG 553

  Fly   321 AVLRKSIDKIRDLQ------RQNHDLKAELQRLQRELMARDGSKVKDL----------------- 362
            .:|:.|:|.|:.|:      |||...:.:::...|:||    |::|:|                 
  Fly   554 TILKSSVDYIKCLKHEVTRLRQNELRQRQVELQNRKLM----SRIKELEMQAKSHGILLSENHLT 614

  Fly   363 -LQLGTRP--------GRASKKRR--------ESSQTFT-TDAGLTPPRSDE-----------SD 398
             |...|:|        ..||:.||        :..|... .|..:...:.||           .|
  Fly   615 SLSAPTQPYLKSFSLSPTASRSRRSLFDQPVEKKIQVIDGADGNMGMNQVDEFMEDCKYAVQGGD 679

  Fly   399 PSLSPMHSDI-SLPPSPYGGSTASCSSGS 426
            |.|| .||.: |.|.||   |:.:.:|||
  Fly   680 PMLS-SHSHMQSAPQSP---SSKTLNSGS 704

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SREBPNP_001262064.1 HLH 281..338 CDD:238036 25/71 (35%)
OmpH <289..>364 CDD:281871 30/107 (28%)
MitfNP_001245436.1 MITF_TFEB_C_3_N <272..>311 CDD:292573 10/39 (26%)
HLH 505..570 CDD:238036 23/64 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1708
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.