DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SREBP and mitfa

DIOPT Version :9

Sequence 1:NP_001262064.1 Gene:SREBP / 40155 FlyBaseID:FBgn0261283 Length:1113 Species:Drosophila melanogaster
Sequence 2:NP_570998.1 Gene:mitfa / 30080 ZFINID:ZDB-GENE-990910-11 Length:412 Species:Danio rerio


Alignment Length:404 Identity:99/404 - (24%)
Similarity:134/404 - (33%) Gaps:165/404 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 SSFVYQSMSP-------PTSPVESANQNVNVMQPVAATPAP-ASAPLPQQSYPQPFITYNSKAGM 216
            ||.:...:||       |:.|.|.           ..||.| ||||    :.|...:|.|.:..|
Zfish    37 SSALGAKLSPQASTGPGPSQPAEH-----------GMTPGPGASAP----NSPMALLTLNCEKEM 86

  Fly   217 T-------------SDEAMYFL---LQPTVASPTPS-----------PP--VAPPPTSTGSRASK 252
            .             ||:.:.|:   ||.|...|..:           ||  |:...:...|..:.
Zfish    87 DDVIEDIISLESSYSDDILGFMDAGLQMTNTIPVSANLLDMYSNHALPPAGVSISNSCPSSLPAV 151

  Fly   253 VRVAPLAPSPAAMEVQGKV---------------PIN-RVQPKVKE-VKRSAHNAIERRYRTSIN 300
            .|...:.|||..|.:..|.               |:. .|:...|| .|:..||.||||.|.:||
Zfish   152 KRELSVTPSPGMMHIMDKAGPCGKFDSYQRPDGFPVEAEVRALAKERQKKDNHNLIERRRRFNIN 216

  Fly   301 DKINELKNLVV---GEQAKLNKSAVLRKSIDKIRDLQRQ-----------------NHDLKAELQ 345
            |:|.||..|:.   ....:.||..:|:.|:|.||.||::                 |..|...:|
Zfish   217 DRIKELGTLIPKSNDPDMRWNKGTILKASVDYIRKLQKEQQKAKELENRQKRLEHANRHLLLRIQ 281

  Fly   346 RLQ------------------RELMAR----------------------DGSKVKDL-LQLGT-- 367
            .|:                  .||:||                      |.|:...| |..||  
Zfish   282 ELEMQARAHGLTVVASSSLYSAELVARAIKQEPGMGDCTSNLYPHLPSPDMSRPTTLDLNNGTIS 346

  Fly   368 ---------------RPGRASKKRRESSQTFTTDAGLTPPRSDESDPSLSPMHSDISLPPSPYGG 417
                           .|.:||.|..:    ...|..|:|..|  |||.||.            |.
Zfish   347 YNDSPTEDGEPGVYDSPNKASTKLED----MLMDNTLSPVGS--SDPLLSS------------GS 393

  Fly   418 STASCSSGSSSSNE 431
            ...|.||||||.:|
Zfish   394 PVPSNSSGSSSMDE 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SREBPNP_001262064.1 HLH 281..338 CDD:238036 26/77 (34%)
OmpH <289..>364 CDD:281871 33/135 (24%)
mitfaNP_570998.1 MITF_TFEB_C_3_N <11..90 CDD:292573 18/67 (27%)
HLH 197..257 CDD:238036 25/59 (42%)
DUF3371 285..392 CDD:288684 23/124 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1708
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.