DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SREBP and SPAC3F10.12c

DIOPT Version :9

Sequence 1:NP_001262064.1 Gene:SREBP / 40155 FlyBaseID:FBgn0261283 Length:1113 Species:Drosophila melanogaster
Sequence 2:NP_593944.1 Gene:SPAC3F10.12c / 2543157 PomBaseID:SPAC3F10.12c Length:201 Species:Schizosaccharomyces pombe


Alignment Length:196 Identity:47/196 - (23%)
Similarity:92/196 - (46%) Gaps:32/196 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 GMTSDEAMY--FLLQPTVASPTPSPPVAPPPTSTGSRASKVRVAPLAPSPAAMEVQGKVPINRVQ 277
            |.|:| .:|  |.......:|.||..:..|..:|..:.|         :.:.:...|...:.:  
pombe    25 GFTND-IVYNDFYAHAVSYNPYPSEKIDFPKKNTAHKNS---------TTSTVASSGNTTMEK-- 77

  Fly   278 PKV-----KEVKRSAHNAIERRYRTSINDKINELKNLVVGEQAKLNKSAVLRKSIDKIRDLQRQN 337
            |.|     .:.||.:|..:|||.|.:|::.|.||.|:|.|  .:.||.::|:::...||.|:...
pombe    78 PCVGSEEWYKAKRLSHKEVERRRREAISEGIKELANIVPG--CEKNKGSILQRTAQYIRSLKEME 140

  Fly   338 HDL--KAELQRLQR----ELMARDGSKVKDLLQLGTRPGRASKKRRESSQTFTTDAGLTPPRSDE 396
            ...  |:.|::|..    :.:||:.:::|...:   |..|:.:..::::::|  |:.|....:.|
pombe   141 EMCREKSNLEKLVADHTIQELARENARLKSECE---RAWRSVELWKQAARSF--DSELDVEENSE 200

  Fly   397 S 397
            |
pombe   201 S 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SREBPNP_001262064.1 HLH 281..338 CDD:238036 20/56 (36%)
OmpH <289..>364 CDD:281871 23/80 (29%)
SPAC3F10.12cNP_593944.1 HLH 87..141 CDD:238036 20/55 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1708
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.