DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SREBP and Mycs

DIOPT Version :9

Sequence 1:NP_001262064.1 Gene:SREBP / 40155 FlyBaseID:FBgn0261283 Length:1113 Species:Drosophila melanogaster
Sequence 2:NP_068609.2 Gene:Mycs / 24581 RGDID:3133 Length:430 Species:Rattus norvegicus


Alignment Length:283 Identity:60/283 - (21%)
Similarity:105/283 - (37%) Gaps:79/283 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 GLLKAAQPTATIHHMDAQRMPPNTAVYPPSLGSSFVYQSMSPPTSPVESANQNVNVMQPVAATPA 192
            |..|||..| .:.|:|::           .:.|:.::     |.:..||        .|||..||
  Rat   172 GRRKAAWLT-ELSHLDSE-----------CVDSAVIF-----PANKRES--------MPVATIPA 211

  Fly   193 PASAPL---PQQSYPQPFITYNSKAGMTSD--EAMYFLL------------QPTV-----ASPTP 235
            .|.|.:   ..|........:.|.:|...:  |.:|.::            .||.     |:.||
  Rat   212 SAGAAISLGDHQGLSSSLEDFLSNSGYVEEGGEEIYVVMLGETQFSKTVTKLPTAAHSENAALTP 276

  Fly   236 SPP-------------------VAPP-PTSTGSRASKVRVA--PLAPSPAAMEVQGKVPINRVQP 278
            ...                   .||| |.:..:|..|...:  ||.|....:..:.....:|...
  Rat   277 ECAQSGELILKRSDLIQEQHNYAAPPLPYAEDARPLKKPRSQDPLGPLKCVLRPKAPRLRSRSNS 341

  Fly   279 KVKEV-KRSAHNAIERRYRTSINDKINELKNLV--VGEQAKLNKSAVLRKSIDKIRDLQRQNHDL 340
            .:::: :|..||.:||:.|..:......|::||  :....|..|..:|:|:.:.|..||.....|
  Rat   342 DLEDIERRRNHNRMERQRRDIMRSSFLNLRDLVPELVHNEKAAKVVILKKATEYIHTLQTDESKL 406

  Fly   341 KAELQRL---QRELMARDGSKVK 360
            ..|.::|   :::|:    .|:|
  Rat   407 LVEREKLYERKQQLL----EKIK 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SREBPNP_001262064.1 HLH 281..338 CDD:238036 16/59 (27%)
OmpH <289..>364 CDD:281871 20/77 (26%)
MycsNP_068609.2 Myc_N 10..331 CDD:395839 37/183 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..326 7/23 (30%)
bHLHzip_N-Myc_like 344..430 CDD:381462 22/86 (26%)
Leucine-zipper 399..420 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2588
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.