DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SREBP and Usf1

DIOPT Version :9

Sequence 1:NP_001262064.1 Gene:SREBP / 40155 FlyBaseID:FBgn0261283 Length:1113 Species:Drosophila melanogaster
Sequence 2:NP_001292605.1 Gene:Usf1 / 22278 MGIID:99542 Length:310 Species:Mus musculus


Alignment Length:288 Identity:65/288 - (22%)
Similarity:105/288 - (36%) Gaps:77/288 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 QQPTGL-LKAAQPTATIHHMDAQRMPPNTA-VYPPSLGSSFVYQSMSPPTSPVESANQNVNVMQP 186
            :.||.: :.:.|..||.       ..||.. |:....|...:|:.:......::...:....:..
Mouse    26 EDPTSVAIASIQSAATF-------PDPNVKYVFRTENGGQVMYRVIQVSEGQLDGQTEGSGAISG 83

  Fly   187 VAATPAPASAPLPQQSYPQPFITYNSKAGMTSDEAM------------YFLLQPTVA-----SPT 234
            ..||          ||..|..|    :...|||:|:            ||   |:.|     ..|
Mouse    84 YPAT----------QSMTQAVI----QGAFTSDDAVDTEGAAAETHYTYF---PSTAVGDGSGGT 131

  Fly   235 PSPPVAPPPTSTGSRASKVRVAP-----------------------LAPSPAAMEVQGKVPINRV 276
            .|.......|:.||.|...:..|                       :||.......:.:.|    
Mouse   132 TSGSTTAVVTTQGSEALLGQATPPSTGQFFVMMSPQEVLQGGSQRSIAPRTHPYSPKSEAP---- 192

  Fly   277 QPKVKEVKRSAHNAIERRYRTSINDKINELKNLVVG---EQAK--LNKSAVLRKSIDKIRDLQRQ 336
            :....|.:|:.||.:|||.|..||:.|.:|..::..   |..|  .:|..:|.|:.|.|::|::.
Mouse   193 RTTRDEKRRAQHNEVERRRRDKINNWIVQLSKIIPDCSMESTKSGQSKGGILSKACDYIQELRQS 257

  Fly   337 NHDLKAELQRLQRELMARD--GSKVKDL 362
            ||.|..|||.|.:..:..|  ..:|:||
Mouse   258 NHRLSEELQGLDQLQLDNDVLRQQVEDL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SREBPNP_001262064.1 HLH 281..338 CDD:238036 20/61 (33%)
OmpH <289..>364 CDD:281871 28/81 (35%)
Usf1NP_001292605.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 65/288 (23%)
UPF0492 <145..>284 CDD:374070 35/142 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..209 7/41 (17%)
bHLHzip_USF1 196..260 CDD:381494 21/63 (33%)
Leucine-zipper 271..292 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1708
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.