DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SREBP and Tfeb

DIOPT Version :9

Sequence 1:NP_001262064.1 Gene:SREBP / 40155 FlyBaseID:FBgn0261283 Length:1113 Species:Drosophila melanogaster
Sequence 2:NP_035679.3 Gene:Tfeb / 21425 MGIID:103270 Length:534 Species:Mus musculus


Alignment Length:405 Identity:99/405 - (24%)
Similarity:161/405 - (39%) Gaps:81/405 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 QSVDQQPQSVEQQPHVKSEHSSPVHIKEELHQQQQQSPLLVYKPDPLIAT--SYNCPQQQPTGLL 130
            |.:.:|.|..||:..::.:  :.:|..::..|||||   |...|.|.|.|  .:..|...|..:|
Mouse    69 QLMREQAQQEEQRERMQQQ--AVMHYMQQQQQQQQQ---LGGPPTPAINTPVHFQSPPPVPGEVL 128

  Fly   131 KA----AQPTATIHHMDAQRMPPNTAVYPPSLGSSFVYQSMSP---PTSPVESANQNVNVMQPVA 188
            |.    ..||:  :|:...:..........:.|:.|. ..:||   ...|..:|:..|.... |.
Mouse   129 KVQSYLENPTS--YHLQQSQHQKVREYLSETYGNKFA-AHVSPAQGSPKPAPAASPGVRAGH-VL 189

  Fly   189 ATPAPASAPLPQQSYPQPFITYNSKAGMTSDEAMYFLLQ---------PTVASPTPSP------- 237
            :|.|..|||    :.|...:..:|......|:.:..:::         |.:..|...|       
Mouse   190 STSAGNSAP----NSPMAMLHISSNPEKEFDDVIDNIMRLDSVLGYINPEMQMPNTLPLSSSHLN 250

  Fly   238 PVAPPPTSTGSRASKVRVAPLAPSPAAMEVQGKVPINRVQPKVKE-VKRSAHNAIERRYRTSIND 301
            ..:..|..|   ||.|.|.. :..||.:..:.::.....:...|| .|:..||.||||.|.:|||
Mouse   251 VYSGDPQVT---ASMVGVTS-SSCPADLTQKRELTDAESRALAKERQKKDNHNLIERRRRFNIND 311

  Fly   302 KINELKNLVVGE---QAKLNKSAVLRKSIDKIR----DLQR----QNHDLKAELQ------RLQR 349
            :|.||..|:...   ..:.||..:|:.|:|.||    |||:    :||..:.|:.      |:|.
Mouse   312 RIKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENHSRRLEMTNKQLWLRIQE 376

  Fly   350 -ELMAR---------DGSKVKDLLQLGTRPGRASKKRRESSQTFTTDAGLTPPRSDESD--PSLS 402
             |:.||         .|..:.:|.|       ...|:...|:....:|.:..|...|.:  |:|.
Mouse   377 LEMQARVHGLPTTSPSGVNMAELAQ-------QVVKQELPSEDGPGEALMLGPEVPEPEQMPALP 434

  Fly   403 PMH--SDISLPPSPY 415
            |..  ...:.|.||:
Mouse   435 PQAPLPSAAQPQSPF 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SREBPNP_001262064.1 HLH 281..338 CDD:238036 27/68 (40%)
OmpH <289..>364 CDD:281871 33/101 (33%)
TfebNP_035679.3 MITF_TFEB_C_3_N 63..219 CDD:292573 39/162 (24%)
HLH 291..351 CDD:238036 24/59 (41%)
DUF3371 379..531 CDD:288684 16/78 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1708
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.