Sequence 1: | NP_001262064.1 | Gene: | SREBP / 40155 | FlyBaseID: | FBgn0261283 | Length: | 1113 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032735.3 | Gene: | Mycn / 18109 | MGIID: | 97357 | Length: | 462 | Species: | Mus musculus |
Alignment Length: | 303 | Identity: | 65/303 - (21%) |
---|---|---|---|
Similarity: | 104/303 - (34%) | Gaps: | 101/303 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 132 AAQPTATIHHMDAQRMPPNTAVYPPSLGSSFVYQSMSPPTSPVESANQNVNVMQPVAATPAPASA 196
Fly 197 PL--PQQSYPQPFITYNSKAGMTSDE--------------------------------------A 221
Fly 222 MYFLLQPTV-------ASP------------------TPSPPV----APPPTSTGSRASKVRVAP 257
Fly 258 LAPSPAAMEVQGKVPINRVQPKVKE----VKRSAHNAIERRYRTSINDKINELKN----LVVGEQ 314
Fly 315 AKLNKSAVLRKSIDKIRDLQRQNHDL---KAELQRLQRELMAR 354 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
SREBP | NP_001262064.1 | HLH | 281..338 | CDD:238036 | 16/64 (25%) |
OmpH | <289..>364 | CDD:281871 | 21/73 (29%) | ||
Mycn | NP_032735.3 | Myc_N | 10..370 | CDD:279405 | 41/214 (19%) |
Interaction with AURKA. /evidence=ECO:0000250|UniProtKB:P04198 | 19..47 | ||||
Interaction with AURKA and FBXW7. /evidence=ECO:0000250|UniProtKB:P04198 | 61..90 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 134..177 | 1/2 (50%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 232..289 | 7/56 (13%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 332..390 | 19/67 (28%) | |||
HLH | 377..436 | CDD:238036 | 16/60 (27%) | ||
Leucine-zipper | 431..452 | 8/20 (40%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2588 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |