DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SREBP and Mycs

DIOPT Version :9

Sequence 1:NP_001262064.1 Gene:SREBP / 40155 FlyBaseID:FBgn0261283 Length:1113 Species:Drosophila melanogaster
Sequence 2:NP_034980.2 Gene:Mycs / 17870 MGIID:1332242 Length:431 Species:Mus musculus


Alignment Length:269 Identity:64/269 - (23%)
Similarity:101/269 - (37%) Gaps:55/269 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 KAAQPTATIHHMDAQ-------------RMPPNTAVYPPSLGSSFV---YQSMSPP-------TS 172
            |||..| .:.|:|.:             |.|......|.|.||:..   :|.:|..       :.
Mouse   174 KAAWLT-ELSHLDLECVDPAVVFFPANKREPMPVPTIPTSTGSAISLGDHQGLSSSLEDFLSNSG 237

  Fly   173 PVESANQNVNVMQPVAATPAPASAPLPQQSYPQPFITYNSKAGMTSDEAM--YFLLQP--TVASP 233
            .||...:.:.|:.......:...:.||..:: |.....:.....:|:..:  |.|:|.  ..|:|
Mouse   238 SVEEGGEEIYVVMLEETQFSKTVSRLPTAAH-QENAALSPGCAQSSELILKRYDLIQEQHNYAAP 301

  Fly   234 TPSPPV----APP---PTSTGSRASKVRVAPLAPSPAAMEVQGKVPINRVQPKVKEVKRSAHNAI 291
             |.|.|    |.|   |.|..|.|.|....|.||...:........|.|         |..||.:
Mouse   302 -PLPYVDREDARPQKKPRSHTSLALKCVFRPKAPRLGSRNNSDWENIER---------RRNHNRM 356

  Fly   292 ERRYRTSINDKINELKNLV--VGEQAKLNKSAVLRKSIDKIRDLQRQNHDLKAELQRL---QREL 351
            ||:.|..:......|::||  :....|..|..:|:|:.:.|..||.....|..|.::|   |::|
Mouse   357 ERQRRDIMRSSFLNLRDLVPELVHNEKAAKVVILKKATEYIHTLQADESKLLVERKKLYERQQQL 421

  Fly   352 MARDGSKVK 360
            :    .|:|
Mouse   422 L----QKIK 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SREBPNP_001262064.1 HLH 281..338 CDD:238036 16/58 (28%)
OmpH <289..>364 CDD:281871 21/77 (27%)
MycsNP_034980.2 Myc_N 10..328 CDD:279405 36/156 (23%)
HLH 348..405 CDD:238036 17/65 (26%)
Leucine-zipper 400..421 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2588
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.