DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ms(3)76Ca and C14C11.1

DIOPT Version :9

Sequence 1:NP_649146.1 Gene:ms(3)76Ca / 40154 FlyBaseID:FBgn0036905 Length:268 Species:Drosophila melanogaster
Sequence 2:NP_504492.1 Gene:C14C11.1 / 182610 WormBaseID:WBGene00015765 Length:346 Species:Caenorhabditis elegans


Alignment Length:319 Identity:60/319 - (18%)
Similarity:119/319 - (37%) Gaps:97/319 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DNLNIWWFPRDFCQSRFGEFQRSGTNSCTIISL-----ILADKVAKADRFYHRVSDLPLRGWELF 67
            :.:::|..|.::.||::|. :::.:::||||::     .|::.|............|||...::.
 Worm    46 NRVHVWVLPLNYSQSKYGG-RKTPSSACTIITVQIAHDFLSNNVCIPPTHLLTPQHLPLGVLDVL 109

  Fly    68 GNAINDGNSVYHNVITT---------------------------NTPHARNLNLNIPDAIAAIRS 105
            .|.|.|||..:...:..                           ..||..  ...:|:||...|.
 Worm   110 INGIVDGNETHEKAMAARRRGFSGSLKKKHLEETVESGSVFQFLKKPHRD--TFTVPEAIQVQRP 172

  Fly   106 Q-HKMNFRLEEWFYTHMEADPSNPMYNRNVAVQ---LSRVFQITLQMFQHASVRNNVPTNLFAAI 166
            : |::::|.....:.      ||.:...::||.   ||::.::.:                  .:
 Worm   173 EMHEIDYRCYSGDFI------SNLVTAMSMAVNSPYLSKLDRLAI------------------GV 213

  Fly   167 IADSRTVMVTFDFRASIVALFDSHQHGR-DAGAVFAQCTLENMDDLLFWFISML-HNVYSSR--P 227
            :|..|.:...:|...:.:.|.|:|.|.: .||:|....:.|::.|.:.....:: |.|:.:.  .
 Worm   214 LAFERAMCFIYDRPTNSIILLDTHMHFKGQAGSVLCVASFEDITDFIVSVTKLVFHEVFKTADVT 278

  Fly   228 SLFEISFL-------------------SSQPGVAKNIPPAIQKKIAADLKKPFKMNMPK 267
            ..|||:.|                   ||.|.|..:||           .||.::...|
 Worm   279 GQFEITCLMLTSLTNKVHKGGIFLPIKSSMPRVTLSIP-----------LKPIRIRAKK 326



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160156274
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CYH9
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1089599at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_127376
Panther 1 1.100 - - O PTHR37962
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.710

Return to query results.
Submit another query.