DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42637 and Adcy3

DIOPT Version :9

Sequence 1:NP_001007096.1 Gene:CG42637 / 40153 FlyBaseID:FBgn0261360 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_570135.2 Gene:Adcy3 / 64508 RGDID:71009 Length:1144 Species:Rattus norvegicus


Alignment Length:731 Identity:157/731 - (21%)
Similarity:272/731 - (37%) Gaps:239/731 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 DPNEIKGYSGNEIVSSPS-------KVSLMSAQSYGSRWTNQFVTSTGRLRGAVVRIKELKFPRK 588
            ||.....||....||.||       :...:|.::.||..             .:.|...|.|..:
  Rat     9 DPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCL-------------CLPRFMRLTFVPE 60

  Fly   589 RDISREIMKEMRLLRELRHDNINSFIGASVEPTRILLVTDYCAKGSLYD--------IIENEDIK 645
               |.|.:.:....|: ||:            |.::||    ...:|:|        ::.:.| |
  Rat    61 ---SLENLYQTYFKRQ-RHE------------TLLVLV----VFAALFDCYVVVMCAVVFSSD-K 104

  Fly   646 LDDLFIA--SLIHDLI------KGMIYIHNSQLVYHGNLKSSNCVVTSRWML---QVTDF-GLHE 698
            |..|.:|  .|:.|:|      ||::....|:.|          |....|:|   |:..: ||:.
  Rat   105 LAPLMVAGVGLVLDIILFVLCKKGLLPDRVSRKV----------VPYLLWLLITAQIFSYLGLNF 159

  Fly   699 LRQCAENESIGEHQHYRNQLWRAPELLRNHIHGSQKGDVYAFAIIMYEIFSRKGPFGQINFEPKE 763
            .|..|.::::|         |:|             ..|::|.|.:           .::..|..
  Rat   160 SRAHAASDTVG---------WQA-------------FFVFSFFITL-----------PLSLSPIV 191

  Fly   764 IVDYV----------------KKLPLKGEDPFRPEVESIIEAESCPDYVLACIRDCWAEDPEERP 812
            |:..|                ::..|:|....| |:.:.:....|.  ::..|...:..|.:.|.
  Rat   192 IISVVSCVVHTLVLGVTVAQQQQDELEGMQLLR-EILANVFLYLCA--IIVGIMSYYMADRKHRK 253

  Fly   813 EFSVIRNRLK-KMRGGKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQS 876
            .|...|..|: ||                     |||           |:..:.|:|:..:||:.
  Rat   254 AFLEARQSLEVKM---------------------NLE-----------EQSQQQENLMLSILPKH 286

  Fly   877 VAEKLTMGQGVEPVSYDL-------------VTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVF 928
            ||:::......:....|.             |:|.|:||||||.:|:..:..::|..||:|:..|
  Rat   287 VADEMLKDMKKDESQKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARF 351

  Fly   929 DRIIRGYDVYKVETIGDAYMVVSGLPIKNGDRHAGEIASMALELLHAVKQHRIAHRPNETLKLRI 993
            |::...|...:::.:||.|..:.|||....| ||.....|.|.::.|:..  :..:....:.:|:
  Rat   352 DKLAAKYHQLRIKILGDCYYCICGLPDYRED-HAVCSILMGLAMVEAISY--VREKTKTGVDMRV 413

  Fly   994 GMHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGEALKIHISN------KCKLALDKLGGG-- 1050
            |:|||.|:.||:|....:|.::...|..|::||:.|...::|||.      |.:..::...||  
  Rat   414 GVHTGTVLGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSR 478

  Fly  1051 --YITEKRGL---VNMKGKGDVVTWWLTGANENAIQKKLVDMMDMPPPLFSRPRKSPKLNPDS-- 1108
              |:.|| |:   :.:..|.:|......|.|.:|:                 |..:|...|.|  
  Rat   479 CDYLDEK-GIETYLIIASKPEVKKTAQNGLNGSAL-----------------PNGAPASKPSSPA 525

  Fly  1109 ----RQPSIQAMHFCGTGS----------------------RRQSTVPRAMD-GESTYSLQGSV- 1145
                ::|:..| |..|:.|                      |.|....|.:| .|..:.|...: 
  Rat   526 LIETKEPNGSA-HASGSTSEEAEEQEAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLN 589

  Fly  1146 -----RESPRMVSKRD 1156
                 |||.::|.||:
  Rat   590 EALLERESAQVVKKRN 605

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42637NP_001007096.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944 62/327 (19%)
HNOBA <835..881 CDD:285003 10/45 (22%)
CYCc 860..1052 CDD:214485 58/214 (27%)
Guanylate_cyc 887..1074 CDD:278633 57/212 (27%)
Adcy3NP_570135.2 AC_N <44..303 CDD:318454 67/370 (18%)
Guanylate_cyc 310..494 CDD:306677 54/187 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 504..563 12/76 (16%)
Guanylate_cyc 914..1121 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.