DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42637 and adcy2a

DIOPT Version :9

Sequence 1:NP_001007096.1 Gene:CG42637 / 40153 FlyBaseID:FBgn0261360 Length:1525 Species:Drosophila melanogaster
Sequence 2:XP_692173.5 Gene:adcy2a / 563724 ZFINID:ZDB-GENE-061109-1 Length:1155 Species:Danio rerio


Alignment Length:265 Identity:83/265 - (31%)
Similarity:129/265 - (48%) Gaps:35/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   836 MMEMMEKYANNLEDIVTERTRLLCEEKMKTED----LLHRMLPQSVAEKLT----MGQGVEPVSY 892
            ::....:|...|:.:...:.:..|||....|:    ||..:||..|||...    ..:.:...||
Zfish   883 VLARQNEYYCRLDFLWKNKFKKECEEIETMENLNRVLLENVLPAHVAEHFLARNWKNEDLYHQSY 947

  Fly   893 DLVTIYFSDIVGFTAMSAES----TPLQVVNFLNDLYTVFDRII---RGYDVYKVETIGDAYMVV 950
            |||.:.|:.|..|.....||    ..|:.:..||::...||.::   :...|.|::|||..||..
Zfish   948 DLVCVMFASIPDFKEFYTESDVNKEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAA 1012

  Fly   951 SGLPIKNG-------DR---HAGEIASMALEL---LHAVKQHRIAHRPNETLKLRIGMHTGPVVA 1002
            :||....|       ||   |.|.:...|..|   |..:.:|..     ...|||:|::.|||.|
Zfish  1013 TGLNATPGPEYTQEHDRQYMHIGTMVEFAFALVGKLDVINKHSF-----NDFKLRVGINHGPVKA 1072

  Fly  1003 GVVGLTMPRYCLFGDTVNTASRMESNGEALKIHISNKCKLALDKLGGGYITEKRGLVNMKGKGDV 1067
            ||:|...|:|.::|:|||.||||:|.|...||.::.:....|..|  ||....||::|:||||::
Zfish  1073 GVIGAQKPQYDIWGNTVNVASRMDSTGVLGKIQVTEETSCILQTL--GYTCSCRGIINVKGKGEL 1135

  Fly  1068 VTWWL 1072
            .|:::
Zfish  1136 KTYFV 1140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42637NP_001007096.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944
HNOBA <835..881 CDD:285003 13/48 (27%)
CYCc 860..1052 CDD:214485 71/219 (32%)
Guanylate_cyc 887..1074 CDD:278633 70/206 (34%)
adcy2aXP_692173.5 AC_N <92..319 CDD:292831
CYCc 295..498 CDD:214485
Guanylate_cyc 340..524 CDD:278633
DUF1053 554..658 CDD:283888
CYCc 912..1120 CDD:214485 69/214 (32%)
Guanylate_cyc 942..1141 CDD:278633 70/206 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.