DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42637 and NPR3

DIOPT Version :9

Sequence 1:NP_001007096.1 Gene:CG42637 / 40153 FlyBaseID:FBgn0261360 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_001191304.1 Gene:NPR3 / 4883 HGNCID:7945 Length:541 Species:Homo sapiens


Alignment Length:540 Identity:111/540 - (20%)
Similarity:207/540 - (38%) Gaps:138/540 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 YLTALTGDLKTRQGLAISGALTMALDEVNKD---PNLLPNVYLDLRWNDTKGDTVLATKAITEMI 91
            ||.:||         .:..|:..||..|..:   ..|||.   ..|:.....|:....:|:..::
Human    65 YLFSLT---------RVRPAIEYALRSVEGNGTGRRLLPP---GTRFQVAYEDSDCGNRALFSLV 117

  Fly    92 CDGIATIFGPE-----GP-C-YVEAIVSQSR---NIPMIS---------YKCAEYRASAIPTFAR 137
             |.:|...|.:     || | |..|.|::..   ::||:|         :|.:||     ....|
Human   118 -DRVAAARGAKPDLILGPVCEYAAAPVARLASHWDLPMLSAGALAAGFQHKDSEY-----SHLTR 176

  Fly   138 TEPPDTQVVKSLLALLRYYAWNKFSILYED---------VWSPVADLLKDQATKRNMTINHKQSF 193
            ..|...::.:.:|||.|::.|::.:::|.|         ....|.::.:::....::     .||
Human   177 VAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEGLHTSI-----YSF 236

  Fly   194 IDNRVKCCEQMLDCCRSGYWYQLVQNTMNRTRIYVFLGAANSLVDFMSSMETAGLFARGEYMVIF 258
            .:.:....|            .:|:|.....|:.:...:::::...|......|: ..|:|....
Human   237 DETKDLDLE------------DIVRNIQASERVVIMCASSDTIRSIMLVAHRHGM-TSGDYAFFN 288

  Fly   259 VDMMVYSEREAEKYLRRVDQITFMSNCHSTENFNQMARSLLVVASTPPTK-DYIQFTKQVQKYSS 322
            :::. .|....:...:|.|:..|.:        .|...||..|......| ::.:|:.:|:....
Human   289 IELF-NSSSYGDGSWKRGDKHDFEA--------KQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVE 344

  Fly   323 KPPFNLEIPRLFVESNFSKFISIYAAYLYDSVKLYAWAVDKMLREETRVLTDDVIFEVASNGTRV 387
            |...|:|           .:::::....:|::.||..|:.::||....          ..:|.::
Human   345 KQGLNME-----------DYVNMFVEGFHDAILLYVLALHEVLRAGYS----------KKDGGKI 388

  Fly   388 IDTIIKNRTYMSITGSKIKIDQYGDSEGNFSVLAYKPHKWNNSNNMPCNYHMVPVAYF-HQG--E 449
            |.. ..|||:..|.| ::.||..||..|:|||:|        ..::......|...|| .:|  |
Human   389 IQQ-TWNRTFEGIAG-QVSIDANGDRYGDFSVIA--------MTDVEAGTQEVIGDYFGKEGRFE 443

  Fly   450 EHPEYKLINGSIDWPSGGEK-PADEPMCGFANEL--------CKKDDTHYTSTVAAVVLGVLLFC 505
            ..|..|       :|.|..| ..||      |.:        ||.......|.|..:|:|.||  
Human   444 MRPNVK-------YPWGPLKLRIDE------NRIVEHTNSSPCKSSGGLEESAVTGIVVGALL-- 493

  Fly   506 SGVITMSIY---RKWKIELE 522
            ...:.|:.|   :|::|.:|
Human   494 GAGLLMAFYFFRKKYRITIE 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42637NP_001007096.1 PBP1_Speract_GC_like 26..445 CDD:107365 86/446 (19%)
ANF_receptor 48..412 CDD:279440 74/395 (19%)
PK_GC-A_B 543..827 CDD:270944
HNOBA <835..881 CDD:285003
CYCc 860..1052 CDD:214485
Guanylate_cyc 887..1074 CDD:278633
NPR3NP_001191304.1 PBP1_NPR_C_like 54..446 CDD:107381 90/456 (20%)
ANF_receptor 71..422 CDD:279440 81/417 (19%)
TM_EphA1 476..507 CDD:214014 8/32 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.