DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42637 and Gycalpha99B

DIOPT Version :9

Sequence 1:NP_001007096.1 Gene:CG42637 / 40153 FlyBaseID:FBgn0261360 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_477088.2 Gene:Gycalpha99B / 43493 FlyBaseID:FBgn0013972 Length:676 Species:Drosophila melanogaster


Alignment Length:229 Identity:100/229 - (43%)
Similarity:136/229 - (59%) Gaps:19/229 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   827 GKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVAEKLTMGQGVEPVS 891
            |:.....|.:...|:|..|::|    |....:.:|:.|...|||.:.|..:||||.:|..::..:
  Fly   401 GEQARAQDGLRRRMDKIKNSIE----EANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSSIDAKT 461

  Fly   892 YDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIRGYDVYKVETIGDAYMVVSGLPIK 956
            |..|||.||||||||::.:.:||..|::.|..||..||.....:||||||||||||.|.|||   
  Fly   462 YPDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGL--- 523

  Fly   957 NGDRH------AGEIASMALELLHAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCLF 1015
                |      |.::|.|||:::.|..:| |.| ..|.:|:|||:|||.|:|||||..|||||||
  Fly   524 ----HRASIYDAHKVAWMALKMIDACSKH-ITH-DGEQIKMRIGLHTGTVLAGVVGRKMPRYCLF 582

  Fly  1016 GDTVNTASRMESNGEALKIHISNKCKLALDKLGG 1049
            |.:|..|::.||..|||||::|...|..|.|..|
  Fly   583 GHSVTIANKFESGSEALKINVSPTTKDWLTKHEG 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42637NP_001007096.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944 100/229 (44%)
HNOBA <835..881 CDD:285003 13/45 (29%)
CYCc 860..1052 CDD:214485 93/196 (47%)
Guanylate_cyc 887..1074 CDD:278633 82/169 (49%)
Gycalpha99BNP_477088.2 HNOB 76..208 CDD:285002
HNOBA 259..451 CDD:285003 15/53 (28%)
CYCc 430..619 CDD:214485 93/196 (47%)
Guanylate_cyc 457..647 CDD:278633 82/169 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454040
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.