DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42637 and Gyc89Db

DIOPT Version :9

Sequence 1:NP_001007096.1 Gene:CG42637 / 40153 FlyBaseID:FBgn0261360 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_650551.1 Gene:Gyc89Db / 42002 FlyBaseID:FBgn0038436 Length:669 Species:Drosophila melanogaster


Alignment Length:315 Identity:104/315 - (33%)
Similarity:169/315 - (53%) Gaps:33/315 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   768 VKKLPLKGEDPFRPEVESIIEAESCPDYVLACIRDCWAEDPEERPEFSVIRNRLKK--------M 824
            ::.:.|||:..:..:|:|:|..  |...:         |:.:|.....:..|.|..        |
  Fly   373 LRSILLKGQMFYIKDVDSLIFL--CSPLI---------ENLDELHGIGLYLNDLNPHGLSRELVM 426

  Fly   825 RGGKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVAEKLTMGQGVEP 889
            .|.:..:.::.|.|..|:.::.||    :...|....|.:.::||:.|:|:.:||::...:....
  Fly   427 AGWQHCSKLEIMFEKEEQRSDELE----KSLELADSWKRQGDELLYSMIPRPIAERM
RKSEEHVC 487

  Fly   890 VSYDLVTIYFSDIVGFTAMSAES--TPLQVVNFLNDLYTVFDRIIRGYDVYKVETIGDAYMVVSG 952
            .|::.|::.|.:::......:.:  ..:|.|..||.:::..|..|....||||||:|..||.|||
  Fly   488 QSFEEVSVIFIEVMNIYDSGSNNIQDAMQAVTTLNKVFSALDEEIISPFVYKVETVGMVYMAVSG 552

  Fly   953 LPIKNGDRHAGEIASMALELLHAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCLFGD 1017
            .|..| ..||.....:||.::..||.|.:   |.  :.:|:|:::|||||||||:.:||||||||
  Fly   553 APDVN-PLHAEHACDLALRVMKKVKAHAL---PG--VAIRVGINSGPVVAGVVGMKVPRYCLFGD 611

  Fly  1018 TVNTASRMESNGEALKIHISNKCKLALDKLGGGYITEKRGLVNMKGKGDVVTWWL 1072
            ||||||||||:.:...|.:||...|.:.|:  ||..|.||.|.:||||::.|:||
  Fly   612 TVNTASRMESSSDPWMIQLSNYTALKVQKV--GYKVEARGFVKVKGKGEMETYWL 664

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42637NP_001007096.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944 12/66 (18%)
HNOBA <835..881 CDD:285003 13/45 (29%)
CYCc 860..1052 CDD:214485 73/193 (38%)
Guanylate_cyc 887..1074 CDD:278633 78/188 (41%)
Gyc89DbNP_650551.1 HNOB 2..161 CDD:400167
HNOBA 218..479 CDD:400168 26/120 (22%)
Nucleotidyl_cyc_III 488..665 CDD:416391 78/185 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454044
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.