DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42637 and CG14877

DIOPT Version :10

Sequence 1:NP_524165.2 Gene:CG42637 / 40153 FlyBaseID:FBgn0261360 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_650507.1 Gene:CG14877 / 41929 FlyBaseID:FBgn0038380 Length:254 Species:Drosophila melanogaster


Alignment Length:229 Identity:56/229 - (24%)
Similarity:86/229 - (37%) Gaps:54/229 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLLLLSVAV----------------RDC-----SNHRTVLTVGYLTALTGDLKTRQGLAISGALT 51
            ||:||.|.:                |||     :|.|. .|:..|..|..|...:..|.....:.
  Fly     2 LLVLLLVGLVFGPKDCVATCREEPARDCEAICDANGRN-CTIRALVLLPDDNMYQASLPRVLPIL 65

  Fly    52 MALDEVNKDPNLLPNVYLDLRW--NDTKGDTVLAT-KAITEMICDGIATIFGPEGPC-YVEAIVS 112
            ...::..:..:|:|: ::|..|  :|||.|..|.. ||:..:|......||||  .| |..|.||
  Fly    66 KVAEQQIRSKSLIPS-HIDFEWLAHDTKCDASLGVIKAMDGIIKQCAQVIFGP--VCDYSLAAVS 127

  Fly   113 Q------SRNIPMISYKCAEYRASAIPT--------FARTEPPDTQVVKSL-LALLRYYAWNKFS 162
            :      |:..|:||...:.|......|        ..||.....:.:..| :.:::.:.|:...
  Fly   128 RITKYFNSQGTPLISVGGSTYDFEQKKTDCNDEFYMLLRTGMLSFETISELTINVMKRHNWSHSI 192

  Fly   163 ILYE-DVWSPVADL---------LKDQATKRNMT 186
            ..|| |....||.:         |..|....|||
  Fly   193 FYYERDGQRSVAGMHTCFLMMKSLGKQMRNENMT 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42637NP_524165.2 PBP1_SAP_GC-like 26..445 CDD:380593 46/190 (24%)
PK_GC-A_B 543..827 CDD:270944
HNOBA <833..881 CDD:462234
CYCc 860..1052 CDD:214485
CG14877NP_650507.1 Periplasmic_Binding_Protein_type1 45..>251 CDD:471960 45/185 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.