DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42637 and Gyc88E

DIOPT Version :9

Sequence 1:NP_001007096.1 Gene:CG42637 / 40153 FlyBaseID:FBgn0261360 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_001036711.1 Gene:Gyc88E / 41825 FlyBaseID:FBgn0038295 Length:1097 Species:Drosophila melanogaster


Alignment Length:671 Identity:192/671 - (28%)
Similarity:281/671 - (41%) Gaps:225/671 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   760 EPKEIVDYVKKLPLKGE--------------DPFRPEVESIIEAE------SCPDYVLACIRDCW 804
            ||:      |.|.|||:              .|..|::.|:|...      |..|:    .||..
  Fly   296 EPE------KSLRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDF----SRDLM 350

  Fly   805 AEDPEERPEFSVIRNRLKKMRGGKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKTEDLL 869
            ....::..|.               |..:||..:..:|        :.|..|||.||..:|::||
  Fly   351 LAGTQQSVEL---------------KLALDQEQQKSKK--------LEESMRLLDEEMRRTDELL 392

  Fly   870 HRMLPQSVAEKLTMGQGVEPVS----YDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDR 930
            ::|:|:.||::|..|:  .|:.    :|.|:|.|||||.||.:.:..||::||:.||.:|::||:
  Fly   393 YQMIPKQVADRLRRGE--NPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDK 455

  Fly   931 IIRGYDVYKVETIGDAYMVVSGLPIKNGDRHAGEIASMALELLHAVK--------QHRIAHRPNE 987
            :.....||||||||||||||:|.|.|:.: ||..:..|||:::.|:.        ||        
  Fly   456 LTERNSVYKVETIGDAYMVVAGAPDKDAN-HAERVCDMALDMVDAITDLKDPSTGQH-------- 511

  Fly   988 TLKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGEALKIHISNKCKLALDKLGGGYI 1052
             |::|:|:|:|.||||:|||.|||||||||||||||||||...|:|:|||...|:.   :|..|.
  Fly   512 -LRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISESTKVL---IGPNYK 572

  Fly  1053 TEKRGLVNMKGKGDVVTWWLTGANENAIQKKLVDMMDMPPPLFSRPRKSPKLN------------ 1105
            ..:||.:::||||.:.|:||. ..||.:..:|...:.:.|.....|..:||..            
  Fly   573 IIERGEIDVKGKGTMGTYWLE-ERENRLPLQLTAALQVHPLSPVPPTPTPKTKAIMPPVSKPLTP 636

  Fly  1106 ------------PDSRQPSIQAMHFCGTGS--------------RRQSTVPRAMDGEST------ 1138
                        |.|..|::..|....:.|              ..|:.|..|:.|.|.      
  Fly   637 MMPVSVSLAASMPTSNVPAVDVMASSSSISGLALTAAAAAHMSLHHQAVVAEALTGASVEVALPS 701

  Fly  1139 -----------------------YS-------LQGSVRESP-RMVSKRDRDRERPPINGLGAGHF 1172
                                   ||       .:.||..|| |..::.|::|.|...:. ..||.
  Fly   702 VASGATGAAAGGGAPSDDRNSRIYSPVTFKDVARRSVANSPVRSCAQPDQERRRESRSN-STGHV 765

  Fly  1173 -------VGGAL-------LESAQASLSTLNHSETNETNCDMDGGSGGVSGSGSGLVRQPNALHK 1223
                   :.|:|       ||..|.|.|:|.::..|::.|              |....|     
  Fly   766 FMRTPSEIFGSLILDTEEFLEDLQISRSSLANNNNNQSPC--------------GFSPTP----- 811

  Fly  1224 PLAMVRPHRIISAAQLPQLGDNDDDSADTL-------------LRE-----SRSLDPMPMQQLRK 1270
                  |.||.||...|:..:.|..:.:.|             .||     |.|||         
  Fly   812 ------PFRIGSAPPKPRPSNPDKFTPEELAAMDQLTPPSTAPARETASCSSASLD--------- 861

  Fly  1271 RHDRVKLPPSKLSKNNSRSLD 1291
            |....||  .|::.:||.|||
  Fly   862 RDKATKL--KKITFSNSSSLD 880

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42637NP_001007096.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944 16/86 (19%)
HNOBA <835..881 CDD:285003 15/45 (33%)
CYCc 860..1052 CDD:214485 94/203 (46%)
Guanylate_cyc 887..1074 CDD:278633 93/198 (47%)
Gyc88ENP_001036711.1 HNOB 2..164 CDD:311572
HNOBA 201..404 CDD:311573 33/140 (24%)
CYCc 383..571 CDD:214485 94/202 (47%)
Herpes_ICP4_C 794..>955 CDD:332854 28/123 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454048
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.