DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42637 and CG32301

DIOPT Version :9

Sequence 1:NP_001007096.1 Gene:CG42637 / 40153 FlyBaseID:FBgn0261360 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_728724.2 Gene:CG32301 / 38285 FlyBaseID:FBgn0052301 Length:1111 Species:Drosophila melanogaster


Alignment Length:240 Identity:60/240 - (25%)
Similarity:122/240 - (50%) Gaps:24/240 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   816 VIRNRLKKMRGGKTKNIMDQMMEMMEKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVAEK 880
            |.:|.:.:|...:.|.::|.::.:  ..|.:|:|.:...          .|:....::|.:....
  Fly   230 VYQNLVFQMAMKEEKALLDSIIPV--TLARSLQDAIASH----------IEEDPSNLMPFTKTRH 282

  Fly   881 LTMGQGVEPVSYDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVFDRIIRGYDVYKVETIGD 945
            |.|    ||  :..|:|..:|:|.||.::.......:|..|::|:..||.........:::.:||
  Fly   283 LFM----EP--HPEVSILEADMVDFTGLTTTMEVSDLVAILHELFVSFDLAANHNRATRIKFLGD 341

  Fly   946 AYMVVSGLPIKNGDRHAGEIASMALELLHAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLTMP 1010
            :|..|:|:| .....||....:.||:::...::  ::.|.|:.:.||||:|:|.::||::|||..
  Fly   342 SYTCVTGIP-SYFPTHANACVNQALDMIEISRE--VSKRRNKKIDLRIGVHSGEILAGIIGLTKW 403

  Fly  1011 RYCLFGDTVNTASRMESNGEALKIHISNKCKLALDKLGGGYITEK 1055
            ::.::...|:..:|:||:|....:|||::   .|..|...|:.|:
  Fly   404 QFDIWSKDVDITNRLESSGLPGMVHISSR---TLGLLDNHYVYEE 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42637NP_001007096.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944 3/10 (30%)
HNOBA <835..881 CDD:285003 5/45 (11%)
CYCc 860..1052 CDD:214485 50/191 (26%)
Guanylate_cyc 887..1074 CDD:278633 48/169 (28%)
CG32301NP_728724.2 Nucleotidyl_cyc_III 283..439 CDD:299850 48/167 (29%)
CYCc 812..1051 CDD:214485
Nucleotidyl_cyc_III 841..1076 CDD:299850
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453931
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.