DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42637 and Phlpp

DIOPT Version :9

Sequence 1:NP_001007096.1 Gene:CG42637 / 40153 FlyBaseID:FBgn0261360 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster


Alignment Length:672 Identity:127/672 - (18%)
Similarity:221/672 - (32%) Gaps:224/672 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   368 ETRVLTDDVIFEVASNGTRVIDTIIKNRTYM---SITGS---KIKIDQYGDSEGNFSVLAYKPHK 426
            ||...:.:.:.|:..|||. :.|::.:..|:   |.|.:   .:|:.:...|..|||.|.    .
  Fly    92 ETLKCSRNKLMELIINGTN-LQTLVADHNYLHNISTTNTHPVPLKLQRIDISHNNFSELP----N 151

  Fly   427 W--------------NNSNNMPC---NYHMVPVAYFHQGEEHPEYKLINGSIDWPSGGEKPADEP 474
            |              |..||:..   ||.:..:.                |:|......|..|:.
  Fly   152 WVGACASLTAINASHNRLNNVAVLLRNYRITELV----------------SLDLAYNDLKQLDQF 200

  Fly   475 MCGF---------ANELCKKDDTHYTSTVA----------------------------------- 495
            ..||         :|||....|..:..|.|                                   
  Fly   201 PEGFSSIRSLQLQSNELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNH 265

  Fly   496 -----------AVVLGVLLFC---SGVITMSIYRKWKIELEIEGLLWKIDPNEIKGYSGNEIVSS 546
                       |..|.||...   .||:..:..|.|. ||||..|            |||.:...
  Fly   266 LNDSIFEPLHNAAKLRVLHLAYNRIGVLPAACVRNWP-ELEILVL------------SGNMLQQL 317

  Fly   547 PSKVSLMSAQSYGSRWTNQFVTSTGRLRGAVVRIKELKFPRKRDISREIMKEMRLL-----RELR 606
            |.:|:.: .|....|..|..:..|.:| ..:..:|.|      |:|...:..:.||     |.|:
  Fly   318 PEEVATL-GQLRVLRCCNNLLLCTPQL-AKLAMLKVL------DLSHNHLDRVNLLALVPSRNLK 374

  Fly   607 HDNINSFIGASVEPTRILLVTDYCAK-GSLYDIIENEDIKLDDLFIASLIHDLIKGMIYIHNSQ- 669
            :.:::..:...|:..:..:......: .||.|:..|..        |:|....|:.:....|.. 
  Fly   375 YLDLSGNLQLQVDEQQFKVCQSQSQRHWSLVDVSGNNR--------AALPTTKIRQVSAQRNQNK 431

  Fly   670 ------LVYHGNLKSSNCVVTSRWMLQVTDFG-----LHELRQCAE--NESIGEHQHYRNQLWRA 721
                  :.:.....|.:|...|.:.|:..::|     |:.:.:..|  ..:..|..|.      .
  Fly   432 TSGPWTMGFAETPGSGDCRKLSVYQLRAANYGGSDEALYGMFEALEGRGRAAQEMSHL------V 490

  Fly   722 PELLRNH--IHGSQKGDVYAFAII-------------MYEIFSRKGPFGQINFEPKEIVDYVKKL 771
            |:|::..  :..|...|...|.::             ::.:...:.|   ....|.:...||.::
  Fly   491 PDLMKQEQMVKDSAVRDYMKFTLLAAQQQCGSVRSAALFHLTRTRAP---SKVRPLKSKRYVLRM 552

  Fly   772 PLKGE-DPF-----------RPEVESIIEAESCPD-YVLACIRDCWAEDPEERPEFSVIRN---- 819
            ...|. |.:           :|:|....:..|.|| :||..|.       ....|:.|:.|    
  Fly   553 ASTGGLDAYLIRRTSQLRLTKPDVIQKDQIHSMPDPHVLELIL-------SNDDEYLVVGNAQLW 610

  Fly   820 -------RLKKMRGGKTKNIM---DQMMEMMEKY--ANNLEDIVTERTRLLCEEKMKTEDLLHRM 872
                   ..:::|  |.:|.:   .:::::.:.:  |.:|..||. |.|.|..:    .|.|.|.
  Fly   611 SVMDIDRAAREIR--KEENSLLAAKRLVDIAQSFAAAESLSVIVV-RFRHLGTD----VDHLIRE 668

  Fly   873 LPQSVAEKLTMGQGVEPVSYDL 894
            |.|||.:|      .:|||..|
  Fly   669 LKQSVRKK------PQPVSLPL 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42637NP_001007096.1 PBP1_Speract_GC_like 26..445 CDD:107365 22/99 (22%)
ANF_receptor 48..412 CDD:279440 11/49 (22%)
PK_GC-A_B 543..827 CDD:270944 56/342 (16%)
HNOBA <835..881 CDD:285003 14/47 (30%)
CYCc 860..1052 CDD:214485 12/35 (34%)
Guanylate_cyc 887..1074 CDD:278633 4/8 (50%)
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 5/17 (29%)
LRR_8 109..169 CDD:290566 13/64 (20%)
leucine-rich repeat 111..135 CDD:275380 4/23 (17%)
leucine-rich repeat 136..158 CDD:275380 6/25 (24%)
leucine-rich repeat 159..183 CDD:275380 5/23 (22%)
leucine-rich repeat 184..209 CDD:275380 6/40 (15%)
LRR_8 205..266 CDD:290566 6/60 (10%)
leucine-rich repeat 210..230 CDD:275380 5/19 (26%)
leucine-rich repeat 232..255 CDD:275380 0/22 (0%)
LRR_RI <256..410 CDD:238064 35/174 (20%)
leucine-rich repeat 256..276 CDD:275380 0/19 (0%)
LRR_8 279..359 CDD:290566 26/100 (26%)
leucine-rich repeat 280..303 CDD:275380 7/23 (30%)
leucine-rich repeat 304..348 CDD:275380 14/57 (25%)
leucine-rich repeat 349..372 CDD:275380 6/28 (21%)
PP2Cc 461..655 CDD:294085 34/212 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.