DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42637 and GUCY1A1

DIOPT Version :9

Sequence 1:NP_001007096.1 Gene:CG42637 / 40153 FlyBaseID:FBgn0261360 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_000847.2 Gene:GUCY1A1 / 2982 HGNCID:4685 Length:690 Species:Homo sapiens


Alignment Length:673 Identity:174/673 - (25%)
Similarity:269/673 - (39%) Gaps:203/673 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   579 RIKELKFPRKRD--------------ISREIMKE------MRLLRELRHDNINSFIGASVEP--- 620
            :|||.:...:|:              :..|::||      .::..| ..:||...:|.:::.   
Human   101 KIKESRKSLEREDFEKTIAEQAVAAGVPVEVIKESLGEEVFKICYE-EDENILGVVGGTLKDFLN 164

  Fly   621 --TRILLVTDYCAKGSLYDIIENEDI----KLDDLFIASLIHDLIKGMIYI----HNSQLVYHGN 675
              :.:|..:.:|.:......:|:..|    |.||     .:|      :|.    ..:.|:..|.
Human   165 SFSTLLKQSSHCQEAGKRGRLEDASILCLDKEDD-----FLH------VYYFFPKRTTSLILPGI 218

  Fly   676 LKSSNCVVTSRWMLQVTDFGLHELRQCAENESIGEHQHYRNQLWRAPELLRNHIHGSQKGDV--- 737
            :|::..|      |..|:..:..:..|..|:.    ..:.||    |.||.:....|.|..:   
Human   219 IKAAAHV------LYETEVEVSLMPPCFHNDC----SEFVNQ----PYLLYSVHMKSTKPSLSPS 269

  Fly   738 --YAFAIIMYEIFSRKGPFGQINFEPKEIVDY---VKKLPLKGEDPFRPEVESIIEAESCPDYVL 797
              .:..:|...:|.:..||..:..:...|:.:   :::|..:.:...:|..|...|       :|
Human   270 KPQSSLVIPTSLFCKTFPFHFMFDKDMTILQFGNGIRRLMNRRDFQGKPNFEEYFE-------IL 327

  Fly   798 ACIRDCWAEDPEERPEFS----------VIRNRLKKMRGGKTKNIMD---QMMEMMEKYA----- 844
            .         |:....||          |:|.|.......|:..:||   ||:.::|..|     
Human   328 T---------PKINQTFSGIMTMLNMQFVVRVRRWDNSVKKSSRVMDLKGQMIYIVESSAILFLG 383

  Fly   845 -----------------------NNLEDIVT--ERTR---------------------LLCEEKM 863
                                   |.|.|:|.  |:.|                     .|.|||.
Human   384 SPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQARAQDGLKKRLGKLKATLEQAHQALEEEKK 448

  Fly   864 KTEDLLHRMLPQSVAEKLTMGQGVEPVSYDLVTIYFSDIVGFTAMSAESTPLQVVNFLNDLYTVF 928
            ||.|||..:.|..||::|..||.|:...:..||:.|||||||||:.::.:||||:..||.|||.|
Human   449 KTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRF 513

  Fly   929 DRIIRGYDVYKVETIGDAYMVVSGLPIKNGDRHAGEIASMALELLHAVKQHRIAHRPNETLKLRI 993
            |:.....||||||||||||.|..||. |..|.||.:||.|||:::....:....|  .|.:|:||
Human   514 DQQCGELDVYKVETIGDAYCVAGGLH-KESDTHAVQIALMALKMMELSDEVMSPH--GEPIKMRI 575

  Fly   994 GMHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGEALKIHISNKCKLALDKLGGGYITEKRGL 1058
            |:|:|.|.|||||:.||||||||:.|..|::.||.....||::|                     
Human   576 GLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVS--------------------- 619

  Fly  1059 VNMKGKGDVVTWWLTGANENAIQKKLVDMMDMPPPLFSRPRKSPKLNPD--SRQPSIQAMHFC-- 1119
                    ..|:.|              :.|.|..:|: ||...:|.|:  |..|.|  .||.  
Human   620 --------PTTYRL--------------LKDCPGFVFT-PRSREELPPNFPSEIPGI--CHFLDA 659

  Fly  1120 ---GTGSRRQSTVPRAMDGESTY 1139
               ||.|:.........||.:.:
Human   660 YQQGTNSKPCFQKKDVEDGNANF 682

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42637NP_001007096.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944 51/298 (17%)
HNOBA <835..881 CDD:285003 22/96 (23%)
CYCc 860..1052 CDD:214485 90/191 (47%)
Guanylate_cyc 887..1074 CDD:278633 78/186 (42%)
GUCY1A1NP_000847.2 HNOBA 277..466 CDD:400168 41/204 (20%)
Guanylate_cyc 472..643 CDD:306677 83/217 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.