DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42637 and Adcy5

DIOPT Version :9

Sequence 1:NP_001007096.1 Gene:CG42637 / 40153 FlyBaseID:FBgn0261360 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_001012783.3 Gene:Adcy5 / 224129 MGIID:99673 Length:1262 Species:Mus musculus


Alignment Length:257 Identity:81/257 - (31%)
Similarity:125/257 - (48%) Gaps:42/257 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   860 EEKMKTED-------LLHRMLPQSVAEKLTMGQGVEPVSY----DLVTIYFSDIVGFT----AMS 909
            |||.:.|:       |||.:||:.||......:......|    :.|.:.|:.|..|:    .:.
Mouse  1025 EEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELE 1089

  Fly   910 AESTPLQVVNFLNDLYTVFDRII---RGYDVYKVETIGDAYMVVSGLP----IKNGDRHAGEIAS 967
            |.:..::.:..||::...||.||   |...:.|::|||..||..|||.    .|.|..|...||.
Mouse  1090 ANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTYDKAGKTHIKAIAD 1154

  Fly   968 MALELLHAVKQHRIAHRPNETLKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGEAL 1032
            .|::|:..:|.  |........:::||::.|||||||:|...|:|.::|:|||.||||:|.|...
Mouse  1155 FAMKLMDQMKY--INEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPD 1217

  Fly  1033 KIHISNKCKLALDKLGGGYITEKRGLVNMKGKGDVVTWWLTGANENAIQKKLVDMMDMPPPL 1094
            :|.::......|  ....|..|.||:|.:||||:::|::|.|.                |||
Mouse  1218 RIQVTTDMYQVL--AANTYQLECRGVVKVKGKGEMMTYFLNGG----------------PPL 1261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42637NP_001007096.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944
HNOBA <835..881 CDD:285003 11/27 (41%)
CYCc 860..1052 CDD:214485 66/213 (31%)
Guanylate_cyc 887..1074 CDD:278633 66/201 (33%)
Adcy5NP_001012783.3 AC_N 1..459 CDD:292831
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..194
CYCc 425..620 CDD:214485
Guanylate_cyc 461..622 CDD:278633
DUF1053 669..761 CDD:283888
CYCc 1037..1238 CDD:214485 63/204 (31%)
Guanylate_cyc 1063..1257 CDD:278633 66/197 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.