DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42637 and gcy-36

DIOPT Version :9

Sequence 1:NP_001007096.1 Gene:CG42637 / 40153 FlyBaseID:FBgn0261360 Length:1525 Species:Drosophila melanogaster
Sequence 2:NP_510557.3 Gene:gcy-36 / 191657 WormBaseID:WBGene00001556 Length:675 Species:Caenorhabditis elegans


Alignment Length:245 Identity:105/245 - (42%)
Similarity:142/245 - (57%) Gaps:18/245 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   838 EMMEKYANNLEDIVTERTRLLCEEKMKTEDLLHRMLPQSVAEKLTMGQGVEPVSYDLVTIYFSDI 902
            |.:|..|.:||           .||.||:.||..|||.|||::|..|..||...|:..|:.|:|:
 Worm   403 EQLENMAKDLE-----------VEKGKTDALLREMLPPSVAQQLKQGLSVEAREYEEATVMFTDV 456

  Fly   903 VGFTAMSAESTPLQVVNFLNDLYTVFDRIIRGYDVYKVETIGDAYMVVSGLPIKNGDRHAGEIAS 967
            ..|..:....||..:|:.||:|:|.|||:|.....|||||:||:||.|.|:| ...|.|...|..
 Worm   457 PTFQQIVPLCTPKDIVHLLNELFTKFDRLIGIQKAYKVETVGDSYMSVGGIP-DLVDDHCEVICH 520

  Fly   968 MALELLHAVKQHRIAHRP--NETLKLRIGMHTGPVVAGVVGLTMPRYCLFGDTVNTASRMESNGE 1030
            :||.:   |.:.|....|  |..|.:|.|:|:|||||||||..|||||||||||||:|||||:..
 Worm   521 LALGM---VMEARTVCDPITNTPLHIRAGIHSGPVVAGVVGAKMPRYCLFGDTVNTSSRMESHSP 582

  Fly  1031 ALKIHISNKCKLALDKLGGGYITEKRGLVNMKGKGDVVTWWLTGANENAI 1080
            ..:||.|...|...:.. |.:..|.||.|.:||||::.|::|..:.:.:|
 Worm   583 IGRIHCSENAKKCAEST-GRFEFEPRGRVQIKGKGEMNTYFLLRSFKRSI 631

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42637NP_001007096.1 PBP1_Speract_GC_like 26..445 CDD:107365
ANF_receptor 48..412 CDD:279440
PK_GC-A_B 543..827 CDD:270944
HNOBA <835..881 CDD:285003 17/42 (40%)
CYCc 860..1052 CDD:214485 89/193 (46%)
Guanylate_cyc 887..1074 CDD:278633 85/188 (45%)
gcy-36NP_510557.3 HNOB 3..167 CDD:285002
HNOBA 217..435 CDD:285003 17/42 (40%)
CYCc 415..604 CDD:214485 89/193 (46%)
Guanylate_cyc 441..624 CDD:278633 84/187 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.